product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
mHuwentoxin-IV
catalog :
STH-101
more info or order :
image
image 1 :

Alomone LabsTopotecanblocks 5-HT3A receptors expressed in HEK 293T cells. - 5-HT3A receptor currents were elicited by 10 M 5-HT delivered every 3 minutes.Topotecan(#T-161) was applied 30 seconds before stimulation at 10 100 and 200 M as indicated and completely inhibited the 5-HT induced current in a dose-dependent and reversible manner.
image 2 :

image 3 :

Alomone LabsmHuwentoxin-IV inhibits NaV1.7 currents in stably transfected HEK cells. - A. Time course ofmHuwentoxin-IV(#STH-101) action on NaV1.7 currents. Maximum current amplitudes were plotted as a function of time. Membrane potential was held at ?100 mV and cells were stimulated by a 50 ms voltage ramp to +20 mV. 100 nM mHuwentoxin-IV were perfused as indicated by the bar (green) during 4 min. B. Superimposed examples of NaV1.7 channel current in the absence (control) and presence (green) of 100 nM mHuwentoxin-IV (taken from the experiment in A).
product information
cat :
STH-101
SKU :
STH-101_0.1 mg
Product Name :
mHuwentoxin-IV
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P83303
Accession Number :
https://www.uniprot.org/uniprotkb/P83303/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti)
Source :
Synthetic peptide
Gene ID :
SCN2A,SCN3A,SCN8A,SCN9A
Product Page - Scientific background :
Huwentoxin-IV (HWTX-IV), a tetrodotoxin-sensitive (TTX-s) Na+ channel blocker, isolated from the venom of the Chinese Bird spider Ornithoctonus huwena1. A naturally modified HWTX-IV (mHWTX-IV), having a molecular mass 18 Da. lower than HWTX-IV, has also been isolated from the venom of the same spider. mHWTX-IV has been shown to have the same amino acid sequence as that of HWTX-IV, except that the N-terminal glutamic acid is replaced by pyroglutamic acid. mHWTX-IV inhibits tetrodotoxin-sensitive NaV channels of dorsal root ganglion neurons with an IC50 nearly equal to native HWTX-IV (IC50 value of 28 nM versus 26 nM). mHWTX-IV shows the same activation and inactivation kinetics seen for native HWTX-IV2.Huwentoxin-IV preferentially inhibits hNaV1.7. NaV1.7 plays a crucial role in pain transduction with familial gain of function mutations linked to several chronic pain disorders, while loss of NaV1.7 function results in congenital insensitivity to pain3.
Supplier :
Alomone Labs
Target :
TTX-sensitive Na+ channels
Long Description :
A Blocker of TTX-Sensitive NaV Channels
Short Description :
A Blocker of TTX-Sensitive NaV Channels
MW :
4088.8 Da
Synonyms :
mutated Huwentoxin-IV, Pyrolidone Huwentoxin-IV
Modifications :
Disulfide bonds between Cys2-Cys17, Cys9-Cys24, and Cys16-Cys31 Ile35 - C-terminal amidation Z= Pyrrolidone carboxylic acid (Glp)
Molecular formula :
C174H276N52O50S6
Effective Concentration :
20 - 500 nM
Activity :
mHWTX-IV inhibits tetrodotoxin-sensitive NaV channels of dorsal root ganglion neurons with an IC50 nearly equal to native HWTX-IV (IC50 value of 28 nM versus 26 nM)1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
ZCLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI-NH2
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments
