Huwentoxin-IV | Alomone Labs STH-100 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Huwentoxin-IV

catalog :

STH-100

more info or order :

Alomone Labs product webpage

citations: 3

Reference
François Moutal L, Dustrude E, Wang Y, Brustovetsky T, Dorame A, Ju W, et al. Inhibition of the Ubc9 E2 SUMO-conjugating enzyme-CRMP2 interaction decreases NaV1.7 currents and reverses experimental neuropathic pain. Pain. 2018;159:2115-2127 pubmed publisher
Slowik D, Henderson R. Benchmarking the stability of human detergent-solubilised voltage-gated sodium channels for structural studies using eel as a reference. Biochim Biophys Acta. 2015;1848:1545-51 pubmed publisher
Dustrude E, Wilson S, Ju W, Xiao Y, Khanna R. CRMP2 protein SUMOylation modulates NaV1.7 channel trafficking. J Biol Chem. 2013;288:24316-31 pubmed publisher

image

image 1 :

Alomone Labs Huwentoxin-IV inhibits NaV1.7 channels heterologously expressed inXenopusoocytes. - A. Time course of current inhibition by 500 nMHuwentoxin-IV(#STH-100) (green). Currents were elicited by a voltage ramp between -80 mV to +20 mV (60 ms) every 10 seconds from holding potential of -80 mV. B. Example traces of current response to voltage ramp application before (black) and during (green) 500 nM Huwentoxin-IV application.

product information

cat :

STH-100

SKU :

STH-100_0.1 mg

Product Name :

Huwentoxin-IV

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P83303

Accession Number :

https://www.uniprot.org/uniprotkb/P83303/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti)

Source :

Synthetic peptide

Gene ID :

SCN2A,SCN3A,SCN8A,SCN9A

Product Page - Scientific background :

Huwentoxin-IV is a 35 amino acid peptidyl toxin isolated from the tarantula Haplopelma schmidti venom and its structure represents a typical cystine knot motif1. Huwentoxin-IV acts selectively on tetrodotoxin-sensitive (TTX-S) voltage-gated Na+ channels, with an IC50 of 30 nM in rat DRG neurons. It preferentially inhibits central neuronal voltage-gated Na+ channel subtypes: hNaV1.7 (IC50 of 26 nM), rNaV1.2 (IC50 of 150 nM), and rNaV1.3 (IC50 of 338 nM), compared with muscle subtypes rNaV1.4 and hNaV1.5 (IC50 is > 10 µM)2. Huwentoxin-IV inhibits Na+ channels by trapping the voltage sensor of domain II of the site 4 in the inward, closed configuration3,4.

Supplier :

Alomone Labs

Target :

TTX-sensitive Na+ channels

Long Description :

A Potent Blocker of Neuronal TTX-Sensitive Voltage-Gated Na+ Channel

Short Description :

A Potent Blocker of Neuronal TTX-Sensitive Voltage-Gated Na+ Channel

MW :

4106.8 Da

Synonyms :

μ-Theraphotoxin-Hs2a, Huwentoxin IV, Huwentoxin-4, HwTx-IV

Modifications :

Disulfide bonds between Cys2-Cys17, Cys9-Cys24, and Cys16-Cys31 Ile35 - C-terminal amidation

Molecular formula :

C174H278N52O51S6

Effective Concentration :

20 - 500 nM

Activity :

Huwentoxin-IV specifically inhibits the neuronal tetrodotoxin-sensitive (TTX-S) voltage-gated Na+ channel (IC50 = 30 nM) in adult rat dorsal root ganglion neurons, while having no significant effect on the tetrodotoxin-resistant (TTX-R) voltage-gated Na+ channel1-3.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥99% (HPLC)

CAS No :

526224-73-7

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI-NH2

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage