product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Huwentoxin-I
catalog :
STH-050
more info or order :
image
image 1 :

Alomone Labs Azasetronblocks 5-HT3A receptors expressed in HEK 293T cells. - 5-HT3A receptor currents were elicited with 10 M 5-HT delivered every 3 minutes. Azasetron (#A-240) was applied 30 seconds before stimulation at 0.5 1 and 20 nM as indicated and inhibited the 5-HT-induced current in a dose-dependent and reversible manner.
image 2 :

Alomone LabsHuwentoxin-I inhibits NaV1.7 currents heterologously expressed in HEK-293 cells. - A. Time course ofHuwentoxin-I(#STH-050) blocking action on NaV1.7 currents. Maximum current amplitudes were plotted as a function of time. Membrane potential was held at -100 mV and cells were stimulated by a 20 ms voltage step to -30 mV. 200 nM Huwentoxin-I were perfused as indicated by the bar (green) during 350 sec. B. Superimposed examples of NaV1.7 channel current in the absence (control) and presence (green) of 200 nM Huwentoxin-I (taken from the experiment in A).
product information
cat :
STH-050
SKU :
STH-050_0.1 mg
Product Name :
Huwentoxin-I
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P56676
Accession Number :
https://www.uniprot.org/uniprotkb/P56676/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti)
Source :
Synthetic peptide
Gene ID :
CACNA1B,SCN1A,SCN2A,SCN3A,SCN4A,SCN8A,SCN9A
Product Page - Scientific background :
Huwentoxin-I (HwTx-I) is a 33-residue peptide toxin that was originally isolated from the venom of the Chinese bird spider (Ornithoctonus huwena). Huwentoxin-I is known to be an inhibitor of tetrodotoxin-sensitive voltage-gated Na+ channels (TTX-S) with IC50 values of ~50 nM and N-type voltage-sensitive Ca2+ channels with IC50 values of ~100 nM in mammalian DRG, hippocampus and insect DUM neurons1. It has only a very weak effect on L-type Ca2+ channels, no effect on TTX-R channels and has virtually no effect on muscle Na+ channels. The selectivity of Huwentoxin-I for Ca2+ channels appears to be higher than ω-conotoxin MVIIA and equivalent to ω-conotoxin GVIA2. Huwentoxin-I demonstrates an antinociceptive effect in the rat model of the formalin test when administrated intrathecally (ED50 ~0.28 µg/kg), without side effects of the ones caused by ω-conotoxin MVIIA3.Huwentoxin-I also blocks neuromuscular transmission by acting on nAChR4.
Supplier :
Alomone Labs
Target :
N-type CaV, TTX-sensitive NaV channels, nAChR
Long Description :
An Antagonist of TTX-Sensitive NaV Channels, N-Type Ca2+ Channels and nAChRs
Short Description :
An Antagonist of TTX-Sensitive NaV Channels, N-Type Ca2+ Channels and nAChRs
MW :
3750 Da
Synonyms :
µ/ω-Theraphotoxin-Hs1a, µ/ω-TRTX-Hh1a, Huwentoxin-1, HwTx-I, Mu/omega-theraphotoxin-Hs1a
Modifications :
Disulfide bonds between: Cys2-Cys17, Cys9-Cys22, and Cys16-Cys29
Molecular formula :
C161H246N48O44S6
Effective Concentration :
50 - 200 nM
Activity :
An inhibitor of TTX-sensitive voltage-gated Na+ channels and N-type voltage-gated Ca2+ channels1. Also found to block neuromuscular transmission2.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
ACKGVFDACTPGKNECCPNRVCSDKHKWCKWKL-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments