chemical

Huwentoxin-I

STH-050

STH-050_0.1 mg

Huwentoxin-I

Non Antibodies

Proteins

P56676

https://www.uniprot.org/uniprotkb/P56676/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti)

Synthetic peptide

CACNA1B,SCN1A,SCN2A,SCN3A,SCN4A,SCN8A,SCN9A

Huwentoxin-I (HwTx-I) is a 33-residue peptide toxin that was originally isolated from the venom of the Chinese bird spider (Ornithoctonus huwena). Huwentoxin-I is known to be an inhibitor of tetrodotoxin-sensitive voltage-gated Na+ channels (TTX-S) with IC50 values of ~50 nM and N-type voltage-sensitive Ca2+ channels with IC50 values of ~100 nM in mammalian DRG, hippocampus and insect DUM neurons1. It has only a very weak effect on L-type Ca2+ channels, no effect on TTX-R channels and has virtually no effect on muscle Na+ channels. The selectivity of Huwentoxin-I for Ca2+ channels appears to be higher than ω-conotoxin MVIIA and equivalent to ω-conotoxin GVIA2. Huwentoxin-I demonstrates an antinociceptive effect in the rat model of the formalin test when administrated intrathecally (ED50 ~0.28 µg/kg), without side effects of the ones caused by ω-conotoxin MVIIA3.Huwentoxin-I also blocks neuromuscular transmission by acting on nAChR4.

Alomone Labs

N-type CaV, TTX-sensitive NaV channels, nAChR

An Antagonist of TTX-Sensitive NaV Channels, N-Type Ca2+ Channels and nAChRs

An Antagonist of TTX-Sensitive NaV Channels, N-Type Ca2+ Channels and nAChRs

3750 Da

µ/ω-Theraphotoxin-Hs1a, µ/ω-TRTX-Hh1a, Huwentoxin-1, HwTx-I, Mu/omega-theraphotoxin-Hs1a

Disulfide bonds between: Cys2-Cys17, Cys9-Cys22, and Cys16-Cys29

C161H246N48O44S6

50 - 200 nM

An inhibitor of TTX-sensitive voltage-gated Na+ channels and N-type voltage-gated Ca2+ channels1. Also found to block neuromuscular transmission2.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

ACKGVFDACTPGKNECCPNRVCSDKHKWCKWKL-OH

Yes

12352202

yes

no