product summary
Loading...
company name :
Alomone Labs
product type :
protein
product name :
ω-Grammotoxin SIA
catalog :
STG-450
more info or order :
product information
cat :
STG-450
SKU :
STG-450_0.1 mg
Product Name :
ω-Grammotoxin SIA
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P605090
Accession Number :
https://www.uniprot.org/uniprotkb/P605090/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Grammostola rosea (Chilean rose tarantula) (Grammostola spatulata)
Source :
Synthetic peptide
Gene ID :
CACNA1A, CACNA1B
Product Page - Scientific background :
ω-Grammotoxin SIA is a 36 amino acid peptidyl toxin originally isolated from the venom of the South American Tarantula spider, Grammostola spatulata. ω-Grammotoxin SIA potently inhibits both CaV2.1 (P-type) and CaV2.2 (N-type) Ca2+ channels by altering the voltage-dependence of channel gating. ω-Grammotoxin SIA caused a concentration-dependent and virtually complete inhibition of K+-evoked influx of 45Ca2+ into either rat or chick brain synaptosomes.1 ω-Grammotoxin SIA at 1 µM, a maximally effective concentration, blocked 52% of IBa in cultured rat hippocampal neurons.2 A concentration of >50 nM toxin completely inhibited Ca2+ currents in Purkinje neurons (predominantly, P-type channels) and in sympathetic neurons (predominantly, N-type channels).3
Supplier :
Alomone Labs
Target :
P-type and N-type Ca2+ channels
Long Description :
A Blocker of CaV2.1 (P-type) and CaV2.2 (N-type) Channels
Short Description :
A Blocker of CaV2.1 (P-type) and CaV2.2 (N-type) Channels
MW :
4109.8 Da
Synonyms :
Omega-theraphotoxin-Gr1a, ω-TRTX-Gr1a, ω-GrTx SIA, ω-GsTx SIA, Omega-GTX SIA
Modifications :
Disulfide bonds between Cys2-Cys16, Cys9-Cys21, and Cys15-Cys30V36 - C-terminal amidation
Molecular formula :
C177H263N53O49S6
Effective Concentration :
50 - 500 nM
Activity :
ω-Grammotoxin SIA is a potent inhibitor of both P- and N-type Ca2+ channels1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
152617-90-8
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV-NH2
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments