chemical

GpTx-1

STG-400

STG-400_0.1 mg

GpTx-1

Non Antibodies

Proteins

P0DL72

https://www.uniprot.org/uniprotkb/P0DL72/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Grammostola porteri (Tarantula spider) (Lasiodora porteri)

Synthetic peptide

SCN1A,SCN2A,SCN3A,SCN8A,SCN9A

GpTx-1 is a 34-residue peptide with inhibitory cystine knot motif and contains 3 important residues near the C-terminus that are critical for potently blocking NaV1.7 channel, with IC50 value of 10 nM The peptide toxin was originally isolated from the Grammostola porteri spider venom1,2. In addition, GpTx-1 demonstrates selectivity against other NaV subtypes including NaV1.4 and NaV1.5 channels.There are nine mammalian subtypes of voltage-gated sodium (NaV) channels: NaV1.1-NaV1.9. These channels responsible for propagating action potentials in excitable cells and are considered to be important therapeutic targets for a wide variety of pathophysiological conditions such as cardiac arrhythmia, and epilepsy. NaV1.7 channel plays an important role in human pain signalling pathway and it is an important therapeutic target for treatment of chronic pain3,4.

Alomone Labs

NaV1.7, NaV1.5, NaV1.4 channels

A Blocker of NaV1.7, NaV1.5 and NaV1.4 Na+ Channels

A Blocker of NaV1.7, NaV1.5 and NaV1.4 Na+ Channels

4073.9 Da

β/ω-TRTX-Gr2a, Toxin GTx1-15, Beta/omega-theraphotoxin-Gr2a

Disulfide bonds between: Cys2-Cys17, Cys9-Cys23, and Cys16-Cys30 Phe34 - C-terminal amidation

C176H271N53O45S7

10 - 200 nM

GpTx-1 is a NaV1.7, NaV1.5 and NaV1.4 Na+ channel blocker1,2.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCKYVF-NH2

Yes

12352202

yes

no