GsAF-II | Alomone Labs STG-350 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

GsAF-II

catalog :

STG-350

more info or order :

Alomone Labs product webpage

image

image 1 :

Alomone LabsDiclofenacenhances KCNQ2/KCNQ3heteromeric channels expressed inXenopusoocytes. - A. Time course of KCNQ2/KCNQ3current enhancement by 100 and 250 MDiclofenac(#D-180). Currents were elicited by application of voltage step from a holding potential of -100 mV to -60 mV (700 msec). B. Superimposed example traces of current responses before and during perfusion of 100 and 250 M Diclofenac as indicated.

image 2 :

image 3 :

Alomone LabsGsAF-II inhibits NaV1.7 currents in stably transfected HEK293T cells. - A. Time course ofGsAF-II(#STG-350) action on NaV1.7 peak currents. Peak current amplitudes were plotted as a function of time. Holding potential was -100 mV and currents were stimulated every 10 seconds by a voltage ramp of 50 msec from holding potential to 60 mV. 1 M GsAF-II was perfused as indicated by the horizontal bar (red). B. Superimposed traces of NaV1.7 channel current in the absence (control) and presence of 1 M (red) GsAF-II perfused during 2.5 min (taken from the experiment in A).

product information

cat :

STG-350

SKU :

STG-350_0.1 mg

Product Name :

GsAF-II

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P61409

Accession Number :

https://www.uniprot.org/uniprotkb/P61409/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Grammostola rosea (Chilean rose tarantula) (Grammostola spatulata)

Source :

Synthetic peptide

Gene ID :

CACNA1C,KCNH2,SCN1A,SCN2A,SCN4A,SCN8A,SCN9A

Product Page - Scientific background :

The tetrodotoxin (TTX)-sensitive Na+ channels are differentially distributed in the central and peripheral nervous system, in skeletal muscle, and in cardiac muscle1. Several venom-derived peptides are known to modify the gating properties of ion channels, and the study of their mechanisms of action is expected to contribute to the elucidation of the molecular motions associated with channel gating2.Tarantula venoms are a library of interesting compounds, some of which are exquisite modulators of many types of ion channels. A large number of spider toxins have been demonstrated to modulate NaV channels3.GsAF-II (also termed κ-theraphotoxin-Gr2c) is a peptidyl toxin originally isolated from the venom of Grammostola rosea spider. This toxin has antinociceptive and antiarrhythmic effects in mammals. The peptide is reported to block the following voltage-gated Na+ channels: NaV1.1, NaV1.2, NaV1.3, NaV1.4, NaV1.6 and NaV1.7 with IC50 values of 5.7, 12, 24, 4, 6.6 and 1.3 µM, respectively. This peptide also blocks hERG1 with an IC50 value of 4.7 µM4.

Supplier :

Alomone Labs

Target :

TTX-sensitive NaV, KV11.1 channels

Long Description :

A Blocker of TTX-Sensitive NaV and KV11.1 Channels

Short Description :

A Blocker of TTX-Sensitive NaV and KV11.1 Channels

MW :

3979.8 Da

Synonyms :

Kappa-theraphotoxin-Gr2c, κ-TRTX-Gr2c, GsAF II, GsAFII, Mechanotoxin-α

Modifications :

Disulfide bonds between: Cys2-Cys16, Cys9-Cys21 and Cys15-Cys25

Molecular formula :

C176H261N47O45S7

Effective Concentration :

1 - 24 µM

Activity :

GsAF-II is a blocker of TTX-sensitive NaV and KV11.1 channels1.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

YCQKWMWTCDEERKCCEGLVCRLWCKKKIEW-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage