This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Alomone Labs
product type :
chemical
product name :
GrTx1
catalog :
STG-250
product information
cat :
STG-250
SKU :
STG-250_0.1 mg
Product Name :
GrTx1
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P85117
Accession Number :
https://www.uniprot.org/uniprotkb/P85117/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Grammostola rosea (Chilean rose tarantula) (Grammostola spatulata)
Source :
Synthetic peptide
Gene ID :
KCNH2,SCN1A,SCN2A,SCN3A,SCN4A,SCN8A,SCN9A
Product Page - Scientific background :
β-theraphotoxin-Gr1a (GrTx1) is a peptidyl toxin originally isolated from the venom of the ''rosean-tarantula'' (Grammostola rosea). GrTx1 has 29 amino-acid residues, compactly folded by three disulfide bridges with a molecular weight of 3697 Da. Sequence analysis reveals that GrTx1 is closely related to other spider toxins reported to affect various distinct ion channel functions1. The toxin inhibits NaV1.1 (IC50 = 0.63 μM), NaV1.2 (IC50= 0.23 μM), NaV1.3 (IC50 = 0.77 μM), NaV1.4 (IC50= 1.29 μM), NaV1.6 (IC50= 0.63 μM), NaV1.7 (IC50= 0.37 μM) and potassium channels KV11.1 (IC50 = 1.2 μM)2.
Supplier :
Alomone Labs
Target :
NaV, KV11.1 channels
Long Description :
A Blocker of NaV and KV11.1 Channels
Short Description :
A Blocker of NaV and KV11.1 Channels
MW :
3697.5 Da
Synonyms :
β-theraphotoxin-Gr1a, β-TRTX-Gr1a
Modifications :
Disulfide bonds between: Cys2-Cys16, Cys9-Cys21 and Cys15-Cys25
Molecular formula :
C159H243N45O41S8
Effective Concentration :
20 - 500 nM
Activity :
GrTx1 is a blocker of voltage-gated Na+ channels and herg1 channels1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
YCQKWMWTCDSKRKCCEDMVCQLWCKKRL-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel