chemical

Ergtoxin-1

STE-450

STE-450_0.1 mg

Ergtoxin-1

Non Antibodies

Proteins

Q86QT3

https://www.uniprot.org/uniprotkb/Q86QT3/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Centruroides noxius (Mexican scorpion)

Synthetic peptide

KCNH2,KCNH6,KCNH7

Ergtoxin-1 was originally isolated from Centruroides noxius scorpion venoMThe peptide toxin specifically blocks KV11.1 (ERG) K+ channels in different tissues and across species1,2. Patch clamp recordings from cultured cell lines and cardiac myocytes showed specific blocking of ERG currents with an IC50 of 16 nM, and increased firing rate in neurons as well as cardiac action potential broadening1,2.

Alomone Labs

KV11.1 K+ channels

A Novel Blocker of ERG1 (KV11.1) K+ Channel

A Novel Blocker of ERG1 (KV11.1) K+ Channel

4730 Da

K+ channel toxin γ-KTx 1.1, CnErg1, CnErgTx1, ErgTx1, ErgTx

Disulfide bonds between: Cys5-Cys23, Cys11-Cys34, Cys20-Cys39, and Cys24-Cys41

C193H287N59O63S9

10 - 100 nM

Ergtoxin-1 is a potent inhibitor of ERG K+ channels of nerve, heart and endocrine cells of different species1,2.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

8006-25-5

Lyophilized

Contact Alomone Labs for technical support and product customization

DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKC
KCA-OH

Yes

12352202

yes

no