product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Ergtoxin-1
catalog :
STE-450
more info or order :
citations: 4
Reference
Sempou E, Kostiuk V, Zhu J, Cecilia Guerra M, Tyan L, Hwang W, et al. Membrane potential drives the exit from pluripotency and cell fate commitment via calcium and mTOR. Nat Commun. 2022;13:6681 pubmed publisher
Cui E, Strowbridge B. Selective attenuation of Ether-a-go-go related K+ currents by endogenous acetylcholine reduces spike-frequency adaptation and network correlation. elife. 2019;8: pubmed publisher
Wynia Smith S, Gillian Daniel A, Satyshur K, Robertson G. hERG gating microdomains defined by S6 mutagenesis and molecular modeling. J Gen Physiol. 2008;132:507-20 pubmed publisher
Milnes J, Dempsey C, Ridley J, Crociani O, Arcangeli A, Hancox J, et al. Preferential closed channel blockade of HERG potassium currents by chemically synthesised BeKm-1 scorpion toxin. FEBS Lett. 2003;547:20-6 pubmed
product information
cat :
STE-450
SKU :
STE-450_0.1 mg
Product Name :
Ergtoxin-1
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
Q86QT3
Accession Number :
https://www.uniprot.org/uniprotkb/Q86QT3/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Centruroides noxius (Mexican scorpion)
Source :
Synthetic peptide
Gene ID :
KCNH2,KCNH6,KCNH7
Product Page - Scientific background :
Ergtoxin-1 was originally isolated from Centruroides noxius scorpion venoMThe peptide toxin specifically blocks KV11.1 (ERG) K+ channels in different tissues and across species1,2. Patch clamp recordings from cultured cell lines and cardiac myocytes showed specific blocking of ERG currents with an IC50 of 16 nM, and increased firing rate in neurons as well as cardiac action potential broadening1,2.
Supplier :
Alomone Labs
Target :
KV11.1 K+ channels
Long Description :
A Novel Blocker of ERG1 (KV11.1) K+ Channel
Short Description :
A Novel Blocker of ERG1 (KV11.1) K+ Channel
MW :
4730 Da
Synonyms :
K+ channel toxin γ-KTx 1.1, CnErg1, CnErgTx1, ErgTx1, ErgTx
Modifications :
Disulfide bonds between: Cys5-Cys23, Cys11-Cys34, Cys20-Cys39, and Cys24-Cys41
Molecular formula :
C193H287N59O63S9
Effective Concentration :
10 - 100 nM
Activity :
Ergtoxin-1 is a potent inhibitor of ERG K+ channels of nerve, heart and endocrine cells of different species1,2.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
8006-25-5
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKC
KCA-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel