product summary
Loading...
company name :
Alomone Labs
product type :
protein
product name :
DkTx-K2
catalog :
STD-020
more info or order :
product information
cat :
STD-020
SKU :
STD-020_0.1 mg
Product Name :
DkTx-K2
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P0CH43
Accession Number :
https://www.uniprot.org/uniprotkb/P0CH43/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti)
Source :
Synthetic peptide
Gene ID :
TRPV1
Product Page - Scientific background :
Double-knot toxin-K2 (DkTx-K2) is one of the two inhibitory cysteine-knot (ICK) lobes that are the receptor-binding subunits of the full-length DkTx toxin (1,2). DkTx, a peptide toxin originally isolated from the venom of the Chinese bird spider Cyriopagopus schmidti (formerly known as Ornithoctonus huwena), selectively and irreversibly activates the transient receptor potential vanilloid 1 (TRPV1) channel by targeting the outer pore domain (1). The two ICK motifs that comprise DkTx (K1 and K2) are highly homologous yet differ in their potency, affinity, and binding orientation to the TRPV1 channel.Full-length DkTx partitions into the cellular membrane and binds bivalently to TRPV1, triggering long-lasting channel activation. In contrast, its monovalent single knots partition into the membrane poorly and activate TRPV1 in a rapidly reversible manner (3-6). DkTx-K2 is a more effective activator of TRPV1 than K1, since K2 binds to the outer channel as part of a protein-protein interface, while K1 initiates membrane interaction. DkTx-K2 therefore binds TRPV1 with higher affinity than K1 (1-3), which makes it a more flexible and specific research tool than native DkTx or capsaicin.One of the most versatile pain receptors, TRPV1, is expressed in nociceptors and plays important roles in the transduction of noxious stimuli and thermosensation. In addition, TRPV1 is widely expressed in non-neuronal cells and has been shown to play an important role in the immune systeM As a receptor for multiple injurious stimuli, TRPV1 has emerged as a new and promising target for developing analgesic and anti-inflammatory drugs (7,8).
Supplier :
Alomone Labs
Target :
TRPV1 channel
Long Description :
A Reversible Activator of TRPV1 Channel
Short Description :
A Reversible Activator of TRPV1 Channel
MW :
3675.3 Da
Synonyms :
Tau-theraphotoxin-Hs1a-K2, Tau-TRTX-Hs1a-K2
Modifications :
Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, Cys15-Cys29
Molecular formula :
C159H233N43O46S6
Effective Concentration :
2 - 10 µM
Activity :
Reversibly activates TRPV1 channel.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
>96% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
NCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYR-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments