product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Ceratotoxin-1
catalog :
STC-680
more info or order :
image
image 1 :

Alomone LabsCeratotoxin-1 blocks NaV1.2 currents heterologously expressed inXenopusoocytes. - A. Time course ofCeratotoxin-1(#STC-680) action on maximum current NaV1.2 amplitude. Maximum peak current amplitudes were plotted as a function of time. Membrane potential was held at -100 mV and oocytes were stimulated by a 100 ms voltage step to -10 mV. 200 nM Ceratotoxin-1 was perfused as indicated by the bar (green) for 200 sec. B. Superimposed examples of NaV1.2 channel peak current in the absence (control) and presence (green) of 200 nM Ceratotoxin-1(taken from the experiment in A).
product information
cat :
STC-680
SKU :
STC-680_0.1 mg
Product Name :
Ceratotoxin-1
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P84507
Accession Number :
https://www.uniprot.org/uniprotkb/P84507/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Ceratogyrus marshalli (Straighthorned baboon tarantula) (Ceratogyrus cornuatus)
Source :
Synthetic peptide
Gene ID :
CACNA1B,SCN1A,SCN2A,SCN4A,SCN5A,SCN9A
Product Page - Scientific background :
There are currently nine types of voltage-gated Na+ (NaV) channels defined and characterized. The channels are responsible for propagation and the creation of action potential in excitable cells1. The channel is comprised of the main α subunit and the β auxiliary subunits. Although the α subunit is sufficient for channel expression it is the β subunit that modifies the kinetics and voltage dependency of the channel. The α subunits are organized in four homologous domains (I-IV) each containing six transmembrane α helices (S1-S6)2.Ceratotoxin-1 (β-theraphotoxin-Cm1a, β-TRTX-Cm1a, CcoTx1) is a NaV channel blocker. This peptide toxin was originally isolated from the spider species Ceratogyrus marshalli (Straighthorned baboon tarantula). The toxin binds to all NaV channels in the central nervous system apart from NaV1.33. Mice injected with 500 pmol of Ceratotoxin-1 exhibited symptoms of neurological toxicity in the form of difficulty of standing, breathing reduction and flaccid paralysis. Ceratotoxin-1 also decreases Na+ influx in NaV1.1, NaV1.2, NaV1.4. It is especially selective for NaV1.2 with an IC50 value of 3±1 nM3.
Supplier :
Alomone Labs
Target :
NaV channels
Long Description :
A Blocker of NaV channels
Short Description :
A Blocker of NaV channels
MW :
4044.6 Da
Synonyms :
β-Theraphotoxin-Cm1a, β-TRTX-Cm1a, CcoTx1
Modifications :
Disulfide bonds between: Cys2-Cys17, Cys9-Cys22 and Cys16-Cys29 Leu33 - C-terminal amidation
Molecular formula :
C172H256N52O50S6
Effective Concentration :
1 - 900 nM
Activity :
Ceratotoxin-1 is a NaV channel blocker1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥99% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
DCLGWFKSCDPKNDKCCKNYTCSRRDRWCKYDL-NH2
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments