product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Charybdotoxin
catalog :
STC-325
more info or order :
citations: 25
| Reference |
|---|
Fellerhoff Losch B, Korol S, Ganor Y, Gu S, Cooper I, Eilam R, et al. Normal human CD4(+) helper T cells express Kv1.1 voltage-gated K(+) channels, and selective Kv1.1 block in T cells induces by itself robust TNFα production and secretion and activation of the NFκB non-canonical pathway. J Neural Transm (Vienna). 2016;123:137-57 pubmed publisher
|
Göpel S, Kanno T, Barg S, Eliasson L, Galvanovskis J, Renstrom E, et al. Activation of Ca(2+)-dependent K(+) channels contributes to rhythmic firing of action potentials in mouse pancreatic beta cells. J Gen Physiol. 1999;114:759-70 pubmed
|
Wilson S, Pappone P. P2 receptor modulation of voltage-gated potassium currents in Brown adipocytes. J Gen Physiol. 1999;113:125-38 pubmed
|
image
image 1 :
Expression of NaV1.3 in HEK-293 transfected cells - Cell surface detection ofNaV1.3 in intact living HEK-293 cells expressing rat NaV1.3. A. Extracellular staining of cells usingAnti-SCN3A (NaV1.3) (extracellular)Antibody (#ASC-023) (red). B. Cells transfected with the empty vector show no NaV1.3 staining. Nuclear staining using DAPI as the counterstain (blue).
image 2 :
Alomone LabsCharybdotoxin inhibits KCa1.1 channels heterologously expressed inXenopusoocytes. - A. Example of time course showing reversible effect of 20 nM and 50 nM Charybdotoxin (#STC-325) during 100 sec application on the current amplitude. Membrane holding potential was -100 mV stepped to 0 mV during 200 ms following another step to 80 mV during 600 msec. B. Superimposed example traces of KCa1.1 channel currents in response to ramp depolarization before (Control) and during the application of 20 nM or 50 nM of Charybdotoxin for 100 sec.
product information
cat :
STC-325
SKU :
STC-325_0.1 mg
Product Name :
Charybdotoxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P13487
Accession Number :
https://www.uniprot.org/uniprotkb/P13487/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Leiurus hebraeus (Hebrew deathstalker scorpion) (Leiurus quinquestriatus hebraeus)
Source :
Synthetic peptide
Gene ID :
KCNMA1, KCNA2, KCNA3, KCNA6
Product Page - Scientific background :
Charybdotoxin was originally isolated from the venom of the Israeli scorpion Leiurus quinquestriatus hebraeus1. Charybdotoxin blocks KCa1.1 (large conductance Ca2+-activated K+, Slo) channels in nM concentrations2 as well as KV1.2 (Kd, 14 nM) and KV1.3 (Kd, 2.6 nM) channels3. However, experiments with cloned KCa1.1 channels demonstrate the strong effect of the sloβ subunits on the potency of block by Charybdotoxin (see for example 4).
Supplier :
Alomone Labs
Target :
KCa1.1, KV1.2, KV1.3 K+ channels
Long Description :
A Blocker of KV1.2, KV1.3 and KCa1.1 K+ Channels
Short Description :
A Blocker of KV1.2, KV1.3 and KCa1.1 K+ Channels
MW :
4296 Da
Synonyms :
K+ channel toxin α-KTx 1.1, ChTX, ChTX-Lq1, ChTx-a
Modifications :
Disulfide bonds between: Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35 Z= Pyrrolidone carboxylic acid (Glp)
Molecular formula :
C176H277N57O55S7
Effective Concentration :
10 -100 nM
Activity :
Charybdotoxin is a potent selective inhibitor of high conductance (maxi-K), different medium and small conductance Ca2+-activated K+ channels, as well as a voltage-dependent K+ channel (KV1.3)1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
95751-30-7
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
ZFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
related products
browse more products
questions and comments