product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Cd1a Toxin
catalog :
STC-260
more info or order :
product information
cat :
STC-260
SKU :
STC-260_0.1 mg
Product Name :
Cd1a Toxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P0DL84
Accession Number :
https://www.uniprot.org/uniprotkb/P0DL84/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Ceratogyrus darlingi (Rear horned baboon tarantula)
Source :
Synthetic peptide
Gene ID :
CACNA1B,SCN10A,SCN1A,SCN2A,SCN9A
Product Page - Scientific background :
Cd1a Toxin (β-theraphotoxin-Cd1a) is a spider toxin, isolated from the venom of the African rear-horned baboon tarantula Ceratogyrus darlingi, a spider species that is mostly native to southern Africa1.Cd1a Toxin was shown to be a potent blocker of Nav1.7 channel and has a modest activity on CaV2.2 channels. Cd1a Toxin reversed spontaneous pain behaviours induced in mice by activation of NaV1.7, demonstrating its analgesic potential1. Physiological and pharmacological studies have demonstrated that Cav channels, including CaV2.2 and a number of NaV channels, including NaV1.7, are involved in nociceptive signaling, playing a critical role in the development of chronic pain associated with tissue and nerve injury1.Cd1a Toxin belongs to NaSpTx family 1, a class of promiscuous toxins that can modulate a range of ion channels, including NaV, CaV, KV, mechanosensitive and proton-gated ion channels. The primary structure of Cd1a strongly suggests that it will fold into an ICK motif that is expected to provide a high level of chemical, thermal and biological stability1.
Supplier :
Alomone Labs
Target :
Nav1.7 and Cav2.2 blocker
Long Description :
Potent blocker of Nav1.7 channel and modest blocker of Cav2.2
Short Description :
Potent blocker of Nav1.7 channel and modest blocker of Cav2.2
MW :
4030.6 Da
Synonyms :
Beta-theraphotoxin-Cd1a, β-theraphotoxin-Cd1a, β-TRTX-Cd1a
Modifications :
Disulfide bonds between: Cys2-Cys17, Cys9-Cys22 and Cys16-Cys29 Leu33 - C-terminal amidation
Molecular formula :
C171H254N52O50S6
Effective Concentration :
100 - 500 nM (Nav 1.7)
Activity :
Cd1a is a potent blocker of Nav1.7 channels and has a modest activity on CaV2.2 channels1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
>95% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
DCLGWFKSCDPKNDKCCKNYSCSRRDRWCKYDL-NH2
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel