Ceratotoxin-2 | Alomone Labs STC-100 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Ceratotoxin-2

catalog :

STC-100

more info or order :

Alomone Labs product webpage

image

image 1 :

Alomone Labs Ceratotoxin-2 inhibits NaV1.2 channels heterologously expressed inXenopusoocytes. - NaV1.2 currents were elicited by application of voltage step of 100 ms from -80 mV (holding potential) to 10 mV. A. Time course of channel activity (peak current amplitude) before (black) and during (green) application of 200 nM Ceratotoxin-2 (#STC-100). B. Example of superimposed current traces before (black) and during (green) application of the toxin taken from the experiment in A.

image 2 :

Western blot analysis of mouse lung (lanes 1 and 4) rat brain (lanes 2 and 5) and mouse brain (lanes 3 and 6)lysates: - 1-3.Anti-ZIP3 (SLC39A3) Antibody(#AZT-003) (1:400).4-6. Anti-ZIP3 (SLC39A3) Antibody preincubated with the negative control antigen.

product information

cat :

STC-100

SKU :

STC-100_0.1 mg

Product Name :

Ceratotoxin-2

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P84508

Accession Number :

https://www.uniprot.org/uniprotkb/P84508 /entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Ceratogyrus marshalli (Straighthorned baboon tarantula) (Ceratogyrus cornuatus)

Source :

Synthetic peptide

Gene ID :

SCN1A, SCN2A, SCN3A, SCN4A, SCN8A, SCN9A, CACNA1B

Product Page - Scientific background :

Ceratotoxin-2 was originally isolated from the Ceratogyrus cornuatus (Ceratogyrus marshalli, Straighthorned baboon tarantula) venom1.Ceratotoxin-2 modulates different voltage-gated Na+ channel subtypes from the central nervous system by shifting the voltage dependence of channel activation to more depolarized potentials and by blocking the inward component of the Na+ current. It is significantly more potent against NaV1.2 channel than the other NaV channel subtypes1.

Supplier :

Alomone Labs

Target :

NaV channels

Long Description :

A Potent Blocker of Central Nervous System Voltage-Gated Na+ Channels

Short Description :

A Potent Blocker of Central Nervous System Voltage-Gated Na+ Channels

MW :

4092.7 Da

Synonyms :

β-Theraphotoxin-Cm1b, β-TRTX-Cm1b, CcoTx2

Modifications :

Disulfide bonds between: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29 Leu33 - C-terminal amidation

Molecular formula :

C177H260N52O49S6

Effective Concentration :

5 nM - 2 µM

Activity :

Ceratotoxin-2 modulates different voltage-gated Na+ channel subtypes from the central nervous system (NaV1.1-NaV1.5 and NaV1.8) by shifting the voltage dependence of channel activation to more depolarized potentials and by blocking the inward component of the Na+ current. It is significantly more potent against the NaV1.2 channel than other NaV channel subtypes1.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

DCLGWFKSCDPKNDKCCKNYTCSRRDRWCKYYL-NH2

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage