product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Ceratotoxin-2
catalog :
STC-100
more info or order :
image
image 1 :

Alomone Labs Ceratotoxin-2 inhibits NaV1.2 channels heterologously expressed inXenopusoocytes. - NaV1.2 currents were elicited by application of voltage step of 100 ms from -80 mV (holding potential) to 10 mV. A. Time course of channel activity (peak current amplitude) before (black) and during (green) application of 200 nM Ceratotoxin-2 (#STC-100). B. Example of superimposed current traces before (black) and during (green) application of the toxin taken from the experiment in A.
image 2 :

Western blot analysis of mouse lung (lanes 1 and 4) rat brain (lanes 2 and 5) and mouse brain (lanes 3 and 6)lysates: - 1-3.Anti-ZIP3 (SLC39A3) Antibody(#AZT-003) (1:400).4-6. Anti-ZIP3 (SLC39A3) Antibody preincubated with the negative control antigen.
product information
cat :
STC-100
SKU :
STC-100_0.1 mg
Product Name :
Ceratotoxin-2
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P84508
Accession Number :
https://www.uniprot.org/uniprotkb/P84508 /entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Ceratogyrus marshalli (Straighthorned baboon tarantula) (Ceratogyrus cornuatus)
Source :
Synthetic peptide
Gene ID :
SCN1A, SCN2A, SCN3A, SCN4A, SCN8A, SCN9A, CACNA1B
Product Page - Scientific background :
Ceratotoxin-2 was originally isolated from the Ceratogyrus cornuatus (Ceratogyrus marshalli, Straighthorned baboon tarantula) venom1.Ceratotoxin-2 modulates different voltage-gated Na+ channel subtypes from the central nervous system by shifting the voltage dependence of channel activation to more depolarized potentials and by blocking the inward component of the Na+ current. It is significantly more potent against NaV1.2 channel than the other NaV channel subtypes1.
Supplier :
Alomone Labs
Target :
NaV channels
Long Description :
A Potent Blocker of Central Nervous System Voltage-Gated Na+ Channels
Short Description :
A Potent Blocker of Central Nervous System Voltage-Gated Na+ Channels
MW :
4092.7 Da
Synonyms :
β-Theraphotoxin-Cm1b, β-TRTX-Cm1b, CcoTx2
Modifications :
Disulfide bonds between: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29 Leu33 - C-terminal amidation
Molecular formula :
C177H260N52O49S6
Effective Concentration :
5 nM - 2 µM
Activity :
Ceratotoxin-2 modulates different voltage-gated Na+ channel subtypes from the central nervous system (NaV1.1-NaV1.5 and NaV1.8) by shifting the voltage dependence of channel activation to more depolarized potentials and by blocking the inward component of the Na+ current. It is significantly more potent against the NaV1.2 channel than other NaV channel subtypes1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
DCLGWFKSCDPKNDKCCKNYTCSRRDRWCKYYL-NH2
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments