chemical

Cn2 Toxin

STC-060

STC-060_0.1 mg

Cn2 Toxin

Non Antibodies

Proteins

P01495

https://www.uniprot.org/uniprotkb/P01495/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Centruroides noxius (Mexican scorpion)

Synthetic protein

SCN8A

Cn2 Toxin is a β-scorpion toxin, isolated from the venom of Centruroides noxius, a Mexican native scorpion species. It belongs to the scorpion β-toxins family that bind to the voltage-sensing domain of voltage-gated sodium (NaV) channels and trap the voltage-sensing domain in the activated state1. This unique toxin is capable of simultaneously inducing both the left shift voltage-dependent activation and a transient resurgent current only in human NaV1.6 channels, among the other TTX-sensitive isoforms2. Cn2 also produced both actions in mouse cerebellar Purkinje neurons and blocked firing at appropriate concentrations2.NaV1.6 plays an essential role in peripheral sensory neurons, specifically at the distal terminals of mechanosensing fibers innervating the skin and colon. NaV1.6 activation by Cn2 Toxin leads to enhanced response to mechanical stimulus in vivo3. Cn2 Toxin facilitates Nav1.6 early channel opening, and increased persistent and resurgent currents in large-diameter DRG neurons in a unique mechanism of action3.Cn2 Toxin was described also as a modifier of the neuronal structure and induces apoptosis and reduction of the proliferation and cell survival in experiments performed in F11 mouse neuroblastoma cells4.The crystal structure of this toxin was determined and it was shown to be a 66 amino acid polypeptide that shares a similar structure with other scorpion toxins acting on sodium channels. It is made of a triple-stranded antiparallel β-sheet and an α-helix, and is stabilized by four disulfide bridges. It contains a hydrophobic core, a hydrophobic patch and a positively charged patch5,6.

Alomone Labs

Nav1.6 channels

An activator of Nav1.6

An activator of Nav1.6

7588.6 Da

Toxin 2, Toxin II.9.2.2, β-mammal toxin Cn2

Disulfide bonds between: Cys12-Cys65, Cys16-Cys41, Cys25-Cys46, Cys29-Cys48 Ser66 - C-terminal amidation

C336H496N90O96S8

0.02 - 0.5 µM

Cn2 toxin simultaneously induces both the left shift voltage-dependent activation and a transient resurgent current only in human Nav1.6 channels. Cn2 also produced both actions in mouse cerebellar Purkinje neurons and blocked firing at appropriate concentrations1.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGG
YCYAFACWCTHLYEQAIVWPLPNKRCS-NH2

Yes

12352202

yes

no