BeKm-1 | Alomone Labs STB-470 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

BeKm-1

catalog :

STB-470

more info or order :

Alomone Labs product webpage

citations: 9

Reference
Vasseur L, Chavanieu A, Combemale S, Caumes C, Beroud R, De Waard M, et al. Fluorescent analogues of BeKm-1 with high and specific activity against the hERG channel. Toxicon X. 2019;2:100010 pubmed publisher
Vasseur L, Cens T, Wagner R, Saint N, Kugler V, Chavanieu A, et al. Importance of the Choice of a Recombinant System to Produce Large Amounts of Functional Membrane Protein hERG. Int J Mol Sci. 2019;20: pubmed publisher
Niculescu D, Hirdes W, Hornig S, Pongs O, Schwarz J. Erg potassium currents of neonatal mouse Purkinje cells exhibit fast gating kinetics and are inhibited by mGluR1 activation. J Neurosci. 2013;33:16729-40 pubmed publisher
Ji H, Tucker K, Putzier I, Huertas M, Horn J, Canavier C, et al. Functional characterization of ether-à-go-go-related gene potassium channels in midbrain dopamine neurons - implications for a role in depolarization block. Eur J Neurosci. 2012;36:2906-16 pubmed publisher
Abi Gerges N, Holkham H, Jones E, Pollard C, Valentin J, Robertson G. hERG subunit composition determines differential drug sensitivity. Br J Pharmacol. 2011;164:419-32 pubmed publisher
Qu Y, Fang M, Gao B, Chui R, Vargas H. BeKm-1, a peptide inhibitor of human ether-a-go-go-related gene potassium currents, prolongs QTc intervals in isolated rabbit heart. J Pharmacol Exp Ther. 2011;337:2-8 pubmed publisher
Gerlach A, Stoehr S, Castle N. Pharmacological removal of human ether-à-go-go-related gene potassium channel inactivation by 3-nitro-N-(4-phenoxyphenyl) benzamide (ICA-105574). Mol Pharmacol. 2010;77:58-68 pubmed publisher
Xu X, Recanatini M, Roberti M, Tseng G. Probing the binding sites and mechanisms of action of two human ether-a-go-go-related gene channel activators, 1,3-bis-(2-hydroxy-5-trifluoromethyl-phenyl)-urea (NS1643) and 2-[2-(3,4-dichloro-phenyl)-2,3-dihydro-1H-isoindol-5-ylamino]-nicotinic acid. Mol Pharmacol. 2008;73:1709-21 pubmed publisher
Milnes J, Dempsey C, Ridley J, Crociani O, Arcangeli A, Hancox J, et al. Preferential closed channel blockade of HERG potassium currents by chemically synthesised BeKm-1 scorpion toxin. FEBS Lett. 2003;547:20-6 pubmed

image

image 1 :

Peptide (C)EADFEKAHRSKK corresponding to amino acid residues 31-42 of rat ZIP3 (AccessionQ5U1X7). 1stintracellular loop.

product information

cat :

STB-470

SKU :

STB-470_0.1 mg

Product Name :

BeKm-1

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

Q9BKB7

Accession Number :

https://www.uniprot.org/uniprotkb/Q9BKB7/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Mesobuthus eupeus (Lesser Asian scorpion) (Buthus eupeus)

Source :

Synthetic peptide

Gene ID :

KCNH2,KCNH6,KCNH7

Product Page - Scientific background :

BeKm-1 was originally isolated from Mesobuthus eupeus scorpion venoM BeKm-1 toxin blocked hERG1 channels expressed in HEK 293 cells with IC50 of 3.3 nM1 The native toxin blocked M currents in differentiated mouse neuroblastoma X rat glioma NG108-15 cells with IC50 of 33 nM2

Supplier :

Alomone Labs

Target :

KV11.1 K+ channels

Long Description :

A Novel ERG1 (KV11.1) K+ Channel Blocker

Short Description :

A Novel ERG1 (KV11.1) K+ Channel Blocker

MW :

4092 Da

Synonyms :

K+ channel toxin γ-KTx 2.1, BeKm 1

Modifications :

Disulfide bonds between: Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35

Molecular formula :

C174H261N51O52S6

Effective Concentration :

2 -10 nM

Activity :

BeKm-1 inhibits ERG1 K+ channel currents and has minimal effect on ELK1 K+ channels.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

CAS No :

524962-01-4

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage