chemical

BmKI Toxin

STB-100

STB-100_0.1 mg

BmKI Toxin

Non Antibodies

Proteins

P45697

https://www.uniprot.org/uniprotkb/P45697/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Mesobuthus martensii (Manchurian scorpion) (Buthus martensii)

Synthetic peptide

para,SCN2A ,SCN3A ,SCN4A ,SCN5A ,SCN8A

BmKI Toxin (Alpha-like toxin BmK-M1) is a peptide toxin originally isolated from Mesobuthus martensii scorpion venoM It is a positive modulator of voltage-gated Na+ channels by inhibiting the inactivation of activated NaV channels. BmKI Toxin activity was demonstrated on NaV1.4, NaV1.5, NaV1.6 channels.The structure of BmKI Toxin includes a motif consisting of one or two short segments of α-helix and a triple-stranded β-sheet, connected by variable regions forming loops1,2.There are nine mammalian subtypes of voltage-gated sodium (NaV) channels: NaV1.1-NaV1.9. These channels responsible for propagating action potentials in excitable cells and are important therapeutic targets for numerous pathophysiological conditions such as cardiac arrhythmia, and epilepsy3.

Alomone Labs

NaV1.4, NaV1.5, NaV1.6

An Activator of NaV Channels

An Activator of NaV Channels

7217 Da

Alpha-like toxin BmK-M1, BmK I, BmK-I, BmK1, Bmk M1, BmKM1

Disulfide bonds between: Cys12-Cys63, Cys16-Cys36, Cys22-Cys46 and Cys26-Cys48

C313H467N91O91S8

500 - 1000 nM

BmKI Toxin inhibits the inactivation of activated voltage-gated Na+ channels.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

VRDAYIAKPHNCVYECARNEYCNDLCTKNGAKSGYCQWV
GKYGNGCWCIELPDNVPIRVPGKCH-OH

Yes

12352202

yes

no