ω-Agatoxin TK | Alomone Labs STA-530 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

ω-Agatoxin TK

catalog :

STA-530

more info or order :

Alomone Labs product webpage

citations: 12

Reference
Robert V, Therreau L, Chevaleyre V, Lepicard E, Viollet C, Cognet J, et al. Local circuit allowing hypothalamic control of hippocampal area CA2 activity and consequences for CA1. elife. 2021;10: pubmed publisher
Nikolaev Y, Feketa V, Anderson E, Schneider E, Gracheva E, Bagriantsev S. Lamellar cells in Pacinian and Meissner corpuscles are touch sensors. Sci Adv. 2020;6: pubmed publisher
Silm K, Yang J, Marcott P, Asensio C, Eriksen J, Guthrie D, et al. Synaptic Vesicle Recycling Pathway Determines Neurotransmitter Content and Release Properties. Neuron. 2019;102:786-800.e5 pubmed publisher
ULLMAN J, Yang J, Sullivan M, Bendor J, Levy J, Pham E, et al. A mouse model of autism implicates endosome pH in the regulation of presynaptic calcium entry. Nat Commun. 2018;9:330 pubmed publisher
Chang Q, Martin L. Voltage-gated calcium channels are abnormal in cultured spinal motoneurons in the G93A-SOD1 transgenic mouse model of ALS. Neurobiol Dis. 2016;93:78-95 pubmed publisher
Hernández González O, Hernández Flores T, Prieto G, Perez Burgos A, Arias García M, Galarraga E, et al. Modulation of Ca2+-currents by sequential and simultaneous activation of adenosine A1 and A 2A receptors in striatal projection neurons. Purinergic Signal. 2014;10:269-81 pubmed publisher
Jover E, Tawk M, Laventie B, Poulain B, Prevost G. Staphylococcal leukotoxins trigger free intracellular Ca(2+) rise in neurones, signalling through acidic stores and activation of store-operated channels. Cell Microbiol. 2013;15:742-58 pubmed publisher
Abitbol K, McLean H, Bessiron T, Daniel H. A new signalling pathway for parallel fibre presynaptic type 4 metabotropic glutamate receptors (mGluR4) in the rat cerebellar cortex. J Physiol. 2012;590:2977-94 pubmed publisher
Abbinanti M, Harris Warrick R. Serotonin modulates multiple calcium current subtypes in commissural interneurons of the neonatal mouse. J Neurophysiol. 2012;107:2212-9 pubmed publisher
Heinke B, Gingl E, Sandkühler J. Multiple targets of ?-opioid receptor-mediated presynaptic inhibition at primary afferent A?- and C-fibers. J Neurosci. 2011;31:1313-22 pubmed publisher
N GOUEMO P, Faingold C, Morad M. Calcium channel dysfunction in inferior colliculus neurons of the genetically epilepsy-prone rat. Neuropharmacology. 2009;56:665-75 pubmed publisher
Xiao Y, RICHTER J, Hurley J. Release of glutamate and CGRP from trigeminal ganglion neurons: Role of calcium channels and 5-HT1 receptor signaling. Mol Pain. 2008;4:12 pubmed publisher

image

image 1 :

Peptide CPEGEMGTYSHGIK corresponding to amino acid residues 136-149 of rat P2X6 receptor (AccessionP51579). Extracellular.

image 2 :

Alomone Labs ?-Agatoxin TK inhibits CaV2.1 channels heterologously expressed inXenopusoocytes. - A. Time course of?-Agatoxin TK(#STA-530) action on CaV2.1 currents. Maximum current amplitude was plotted as a function of time. Membrane potential was held at -100 mV and oocytes were stimulated by a 100 ms voltage ramp to +50 mV in the presence of 2 mM Ba2+. 1 M ?-Agatoxin TK was perfused as indicated by the bar for 300 s (green). B. Superimposed example of CaV2.1 channel current in the absence (control) and presence (green) of 1 M ?-Agatoxin TK (taken from the experiment in A).

product information

cat :

STA-530

SKU :

STA-530_0.1 mg

Product Name :

ω-Agatoxin TK

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P37045

Accession Number :

https://www.uniprot.org/uniprotkb/P37045/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Agelenopsis aperta (North American funnel-web spider) (Agelenopsis gertschi)

Source :

Synthetic peptide

Gene ID :

CACNA1A

Product Page - Scientific background :

ω-Agatoxin TK is a peptide toxin originally isolated from Agelenopsis aperta spider venoM ω-Agatoxin TK was shown to be a selective and reversible blocker of CaV2.1 (P/Q type) channels1. Originally the toxin was designated ω-Agatoxin IVB5-8.

Supplier :

Alomone Labs

Target :

P-type and Q-type Ca2+ channels

Long Description :

A Blocker of P/Q-Type CaV Channels

Short Description :

A Blocker of P/Q-Type CaV Channels

MW :

5273 Da

Synonyms :

ω-Agatoxin IVB, Omega-agatoxin IVC , Omega-agatoxin-Aa4b, Omega-AGTX-Aa4b, Omega-agatoxin tsukuba (ω-Aga-TK), Omega-agatoxin-4B

Modifications :

Disulfide bonds between: Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34 Ser46 - D-amino acid

Molecular formula :

C215H337N65O70S10

Effective Concentration :

20 nM - 1 µM

Activity :

ω-Agatoxin TK is an antagonist of voltage-sensitive P-type Ca2+ channels1.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥99% (HPLC)

CAS No :

158484-42-5

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPR
LIMEGLSFA-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

Cited Application :

Electrophysiology

more info or order :

Alomone Labs product webpage