product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Agitoxin-2
catalog :
STA-420
more info or order :
citations: 4
Reference
Bende N, Dziemborowicz S, Mobli M, Herzig V, Gilchrist J, Wagner J, et al. A distinct sodium channel voltage-sensor locus determines insect selectivity of the spider toxin Dc1a. Nat Commun. 2014;5:4350 pubmed publisher
Wu S, Hsu M, Liao Y, Wu F, Jong Y, Lo Y. Evidence for inhibitory effects of flupirtine, a centrally acting analgesic, on delayed rectifier k(+) currents in motor neuron-like cells. Evid Based Complement Alternat Med. 2012;2012:148403 pubmed publisher
Takacs Z, Toups M, Kollewe A, Johnson E, Cuello L, Driessens G, et al. A designer ligand specific for Kv1.3 channels from a scorpion neurotoxin-based library. Proc Natl Acad Sci U S A. 2009;106:22211-6 pubmed publisher
Menteyne A, Levavasseur F, Audinat E, Avignone E. Predominant functional expression of Kv1.3 by activated microglia of the hippocampus after Status epilepticus. PLoS ONE. 2009;4:e6770 pubmed publisher
image
image 1 :
Alomone Labs STA-420 image 1
Alomone LabsAgitoxin-2 inhibits KV1.3 currents heterologously expressed inXenopusoocytes. - A. Time course ofAgitoxin-2(#STA-420) action on KV1.3 currents. Maximum current amplitudes at +50 mV were plotted as a function of time. Membrane potential was held at ?80 mV and cells were stimulated by a 150 ms voltage ramp to +50 mV. 1 nM Agitoxin-2 was perfused as indicated by the bar (green) during 150 sec. B. Superimposed examples of KV1.3 channel current in the absence (control) and presence (green) of 1 nM Agitoxin-2 (taken from the experiment in A).
product information
cat :
STA-420
SKU :
STA-420_0.1 mg
Product Name :
Agitoxin-2
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P46111
Accession Number :
https://www.uniprot.org/uniprotkb/P46111/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Leiurus hebraeus (Hebrew deathstalker scorpion) (Leiurus quinquestriatus hebraeus)
Source :
Synthetic peptide
Gene ID :
KCNA1, KCNA2, KCNA3, KCNA6
Product Page - Scientific background :
Native Agitoxin-2 was originally isolated from the venom of the Israeli scorpion L. quinquestriatus hebraeus.1 Agitoxin-2 inhibited the native KV1.3-like current in cultured microglia by 72% at 5 nM and KV1.3 in MLS-9 cells by 87%.2 Agitoxin-2 is a potent blocker of the Shaker voltage-gated K+-channels as well as the mammalian homologues of Shaker.1
Supplier :
Alomone Labs
Target :
KV1.3 K+ channels
Long Description :
A Potent Blocker of KV1.3 K+ Channels
Short Description :
A Potent Blocker of KV1.3 K+ Channels
MW :
4091 Da
Synonyms :
Potassium channel toxin α-KTx 3.2, AgTx-2, AgTx2, Agitoxin 2
Modifications :
Disulfide bonds between: Cys8-Cys28, Cys14-Cys33, and Cys18-Cys35
Molecular formula :
C169H278N54O48S8
Effective Concentration :
50 pM - 10 nM
Activity :
Agitoxin-2 is a blocker of Shaker voltage-gated K+ channels as well as the mammalian homologues of Shaker.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
168147-41-9
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel