product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
AmmTx3 Toxin
catalog :
STA-305
more info or order :
citations: 1
image
image 1 :

Alomone Labs AmmTx3 Toxininhibits KV4.2 currents heterologously expressed inXenopusoocytes. - A. Time course of AmmTx3 Toxin(#STA-305) blocking action on KV4.2 currents. Maximum current amplitudes were plotted as a function of time. Membrane potential was held at ?90 mV and cells were stimulated by a 120 ms voltage step to 0 mV. 5 M AmmTx3 Toxin were perfused as indicated by the bar (green) during 280 sec application. B. Superimposed examples of KV4.2 channel current in the absence (control) and presence (green) of 5 M AmmTx3 Toxin (taken from the experiment in A).
product information
cat :
STA-305
SKU :
STA-305_0.1 mg
Product Name :
AmmTx3 Toxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P60208
Accession Number :
https://www.uniprot.org/uniprotkb/P60208/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Androctonus mauritanicus mauritanicus (Scorpion)
Source :
Synthetic peptide
Gene ID :
KCND1,KCND2,KCND3,KCNH2
Product Page - Scientific background :
AmmTX3 is a member of the α-KTX15 family of scorpion toxins which includes 6 homologous peptides found in four species of scorpion venoms -Aa1, AaTX1, AaTX2, AmmTX3, BmTX3 and Discrepin. AmmTx3 shares homology of 94% with Aa1 and 91% with BmTx3 and is originally isolated from the venom of the scorpion Androctonus mauretanicus. This toxin selectively blocks A-type K+ channels in cerebellum granular cells or cultured striatum neurons from rat brain.AmmTx3 is a pore blocker of KV4.2 and KV4.3 subunits and requires for its action the expression of the KV4 associated protein dipeptidyl peptidase-like proteins 6 (DPP6). AmmTX3 structure consists of a single chain of 37 amino acid residues cross-linked by three disulphide bridges1,2.
Supplier :
Alomone Labs
Target :
KV4 K+ channels
Long Description :
A Blocker of A-Type K+ Channels
Short Description :
A Blocker of A-Type K+ Channels
MW :
3822 Da
Synonyms :
Potassium channel toxin α-KTx 15.3
Modifications :
Disulfide bonds between: Cys8-Cys28, Cys13-Cys33, and Cys17-Cys35 Z= Pyrrolidone carboxylic acid
Molecular formula :
C158H262N50O48S6
Effective Concentration :
1 - 5 µM
Activity :
AamTx3 Toxin is a blocker of A-type voltage-gated K+ channels as well as ERG1, KV11.1 and KCNH2 K+ channels1,2.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
ZIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments
