AmmTx3 Toxin | Alomone Labs STA-305 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

AmmTx3 Toxin

catalog :

STA-305

more info or order :

Alomone Labs product webpage

citations: 1

Reference
Chittajallu R, Auville K, Mahadevan V, Lai M, Hunt S, Calvigioni D, et al. Activity-dependent tuning of intrinsic excitability in mouse and human neurogliaform cells. elife. 2020;9: pubmed publisher

image

image 1 :

Alomone Labs AmmTx3 Toxininhibits KV4.2 currents heterologously expressed inXenopusoocytes. - A. Time course of AmmTx3 Toxin(#STA-305) blocking action on KV4.2 currents. Maximum current amplitudes were plotted as a function of time. Membrane potential was held at ?90 mV and cells were stimulated by a 120 ms voltage step to 0 mV. 5 M AmmTx3 Toxin were perfused as indicated by the bar (green) during 280 sec application. B. Superimposed examples of KV4.2 channel current in the absence (control) and presence (green) of 5 M AmmTx3 Toxin (taken from the experiment in A).

product information

cat :

STA-305

SKU :

STA-305_0.1 mg

Product Name :

AmmTx3 Toxin

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P60208

Accession Number :

https://www.uniprot.org/uniprotkb/P60208/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Androctonus mauritanicus mauritanicus (Scorpion)

Source :

Synthetic peptide

Gene ID :

KCND1,KCND2,KCND3,KCNH2

Product Page - Scientific background :

AmmTX3 is a member of the α-KTX15 family of scorpion toxins which includes 6 homologous peptides found in four species of scorpion venoms -Aa1, AaTX1, AaTX2, AmmTX3, BmTX3 and Discrepin. AmmTx3 shares homology of 94% with Aa1 and 91% with BmTx3 and is originally isolated from the venom of the scorpion Androctonus mauretanicus. This toxin selectively blocks A-type K+ channels in cerebellum granular cells or cultured striatum neurons from rat brain.AmmTx3 is a pore blocker of KV4.2 and KV4.3 subunits and requires for its action the expression of the KV4 associated protein dipeptidyl peptidase-like proteins 6 (DPP6). AmmTX3 structure consists of a single chain of 37 amino acid residues cross-linked by three disulphide bridges1,2.

Supplier :

Alomone Labs

Target :

KV4 K+ channels

Long Description :

A Blocker of A-Type K+ Channels

Short Description :

A Blocker of A-Type K+ Channels

MW :

3822 Da

Synonyms :

Potassium channel toxin α-KTx 15.3

Modifications :

Disulfide bonds between: Cys8-Cys28, Cys13-Cys33, and Cys17-Cys35 Z= Pyrrolidone carboxylic acid

Molecular formula :

C158H262N50O48S6

Effective Concentration :

1 - 5 µM

Activity :

AamTx3 Toxin is a blocker of A-type voltage-gated K+ channels as well as ERG1, KV11.1 and KCNH2 K+ channels1,2.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

ZIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage