APETx2 | Alomone Labs STA-160 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

APETx2

catalog :

STA-160

more info or order :

Alomone Labs product webpage

citations: 10

Reference
Holton C, Strother L, Dripps I, Pradhan A, Goadsby P, Holland P. Acid-sensing ion channel 3 blockade inhibits durovascular and nitric oxide-mediated trigeminal pain. Br J Pharmacol. 2020;177:2478-2486 pubmed publisher
Chang C, Fong S, Lee C, Chuang Y, Lin S, Chen C. Involvement of Acid-Sensing Ion Channel 1b in the Development of Acid-Induced Chronic Muscle Pain. Front Neurosci. 2019;13:1247 pubmed publisher
Burgos Vega C, Quigley L, Avona A, PRICE T, Dussor G. Dural stimulation in rats causes brain-derived neurotrophic factor-dependent priming to subthreshold stimuli including a migraine trigger. Pain. 2016;157:2722-2730 pubmed
Gao M, Long H, Ma W, Liao L, Yang X, Zhou Y, et al. The role of periodontal ASIC3 in orofacial pain induced by experimental tooth movement in rats. Eur J Orthod. 2016;38:577-583 pubmed
Chen W, Lee C, Lin S, Wong C, Sun W, Wood J, et al. Roles of ASIC3, TRPV1, and NaV1.8 in the transition from acute to chronic pain in a mouse model of fibromyalgia. Mol Pain. 2014;10:40 pubmed publisher
Chen W, Chen C. Acid mediates a prolonged antinociception via substance P signaling in acid-induced chronic widespread pain. Mol Pain. 2014;10:30 pubmed publisher
Moshourab R, Wetzel C, Martinez Salgado C, Lewin G. Stomatin-domain protein interactions with acid-sensing ion channels modulate nociceptor mechanosensitivity. J Physiol. 2013;591:5555-74 pubmed publisher
Yan J, Wei X, Bischoff C, Edelmayer R, Dussor G. pH-evoked dural afferent signaling is mediated by ASIC3 and is sensitized by mast cell mediators. Headache. 2013;53:1250-61 pubmed publisher
Durham P, Masterson C. Two mechanisms involved in trigeminal CGRP release: implications for migraine treatment. Headache. 2013;53:67-80 pubmed publisher
Izumi M, Ikeuchi M, Ji Q, Tani T. Local ASIC3 modulates pain and disease progression in a rat model of osteoarthritis. J Biomed Sci. 2012;19:77 pubmed publisher

image

image 1 :

Expression of ASIC channels in rat locus coeruleus - Immunohistochemical staining of perfusion-fixed rat brain frozen sectionsusingAnti-pan ASIC (extracellular)Antibody(#ASC-031) (1:400) followed by goat-anti-rabbit-AlexaFluor-488. ASIC channel staining (green) appears in neuronal soma (arrows). Nuclei are stained with DAPI (blue).

product information

cat :

STA-160

SKU :

STA-160_0.1 mg

Product Name :

APETx2

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P61542

Accession Number :

https://www.uniprot.org/uniprotkb/P61542/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Anthopleura elegantissima (Green aggregating anemone) (Actinia elegantissima)

Source :

Synthetic peptide

Gene ID :

ASIC3 ,KCNH2,SCN10A,SCN2A

Product Page - Scientific background :

Natural APETx2 is a 42-amino-acid peptidyl toxin, originally isolated from the sea anemone Anthopleura elegantissima. APETx2 was shown to be a selective, potent and reversible blocker of the homodimer proton gated channel ASIC3. ASIC3 has been implicated in pain transduction associated with acidosis in inflamed or ischemic tissues. APETx2 directly inhibits the ASIC3 channel by acting at its external side of the channel in a pH dependent manner.APETx2 also inhibits the hetromer ASIC2b-ASIC3 channel but does not inhibit the activity of ASIC1 isoform1.Structurally APETx2 is related to APETx1 a toxin that targets HERG K+ channel1,2.

Supplier :

Alomone Labs

Target :

ASIC3 channels

Long Description :

A Blocker of ASIC3 Channel

Short Description :

A Blocker of ASIC3 Channel

MW :

4561 Da

Synonyms :

Toxin APETx2, Pi-AITX-Ael2b, Pi-actitoxin-Ael2b

Modifications :

Disulfide bonds between: Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38

Molecular formula :

C196H280N54O61S6

Effective Concentration :

10 nM - 3 µM

Activity :

APETx2 inhibits ASIC3 channels1.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

CAS No :

713544-47-9

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCT
PAD-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage