AaH1 Toxin | Alomone Labs STA-155 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

AaH1 Toxin

catalog :

STA-155

more info or order :

Alomone Labs product webpage

image

image 1 :

Western blot analysis of mouse brain membranes (lanes 1 and 3) and human SH-SY5Y neuroblastoma cell line lysate (lanes 2 and 4): - 1-2.Anti-pan ASIC (extracellular) Antibody (#ASC-031) (1:500).3-4. Anti-pan ASIC (extracellular) Antibody preincubated with the negative control antigen.

image 2 :

product information

cat :

STA-155

SKU :

STA-155_0.1 mg

Product Name :

AaH1 Toxin

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P01479

Accession Number :

https://www.uniprot.org/uniprotkb/P01479/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Androctonus australis (Sahara scorpion)

Source :

Synthetic protein

Gene ID :

SCN1A, SCN2A, SCN3A, SCN4A, SCN5A, SCN8A, SCN9A

Product Page - Scientific background :

AaH1 Toxin is a low molecular weight peptide toxin originally isolated from Androctonus australis scorpion venoM It blocks the fast inactivation phase of voltage-gated Na+ channels1-3. AaH1 Toxin is one of four α-toxins: AahI, AahII, AahIII, and AahIV which account for 95% of the venom lethality2.There are nine mammalian subtypes of voltage-gated sodium (NaV) channels: NaV1.1-NaV1.9. They are responsible for propagating action potentials in excitable cells and are considered to be important therapeutic targets in numerous pathophysiological conditions such as cardiac arrhythmia and epilepsy4.

Supplier :

Alomone Labs

Target :

NaV channels

Long Description :

A Potent NaV Channel Inhibitor of Inactivation

Short Description :

A Potent NaV Channel Inhibitor of Inactivation

MW :

6804 Da

Synonyms :

Neurotoxin-1/1', AaH I, AaH I', AaHI/AaHI', Neurotoxin I/I'

Modifications :

Disulfide bonds between: Cys12-Cys62, Cys16-Cys34, Cys20-Cys44 and Cys24-Cys46

Molecular formula :

C293H452N82O89S8

Effective Concentration :

1 µM

Activity :

AaH1 Toxin is a NaV channel activator. It blocks the fast inactivation of the channel1.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

KRDGYIVYPNNCVYHCVPPCDGLCKKNGGSSGSCSFLVP
SGLACWCKDLPDNVPIKDTSRKCT-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage