product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
AaH1 Toxin
catalog :
STA-155
more info or order :
image
image 1 :
Alomone Labs STA-155 image 1
Western blot analysis of mouse brain membranes (lanes 1 and 3) and human SH-SY5Y neuroblastoma cell line lysate (lanes 2 and 4): - 1-2.Anti-pan ASIC (extracellular) Antibody (#ASC-031) (1:500).3-4. Anti-pan ASIC (extracellular) Antibody preincubated with the negative control antigen.
image 2 :
Alomone Labs STA-155 image 2
product information
cat :
STA-155
SKU :
STA-155_0.1 mg
Product Name :
AaH1 Toxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P01479
Accession Number :
https://www.uniprot.org/uniprotkb/P01479/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Androctonus australis (Sahara scorpion)
Source :
Synthetic protein
Gene ID :
SCN1A, SCN2A, SCN3A, SCN4A, SCN5A, SCN8A, SCN9A
Product Page - Scientific background :
AaH1 Toxin is a low molecular weight peptide toxin originally isolated from Androctonus australis scorpion venoM It blocks the fast inactivation phase of voltage-gated Na+ channels1-3. AaH1 Toxin is one of four α-toxins: AahI, AahII, AahIII, and AahIV which account for 95% of the venom lethality2.There are nine mammalian subtypes of voltage-gated sodium (NaV) channels: NaV1.1-NaV1.9. They are responsible for propagating action potentials in excitable cells and are considered to be important therapeutic targets in numerous pathophysiological conditions such as cardiac arrhythmia and epilepsy4.
Supplier :
Alomone Labs
Target :
NaV channels
Long Description :
A Potent NaV Channel Inhibitor of Inactivation
Short Description :
A Potent NaV Channel Inhibitor of Inactivation
MW :
6804 Da
Synonyms :
Neurotoxin-1/1', AaH I, AaH I', AaHI/AaHI', Neurotoxin I/I'
Modifications :
Disulfide bonds between: Cys12-Cys62, Cys16-Cys34, Cys20-Cys44 and Cys24-Cys46
Molecular formula :
C293H452N82O89S8
Effective Concentration :
1 µM
Activity :
AaH1 Toxin is a NaV channel activator. It blocks the fast inactivation of the channel1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
KRDGYIVYPNNCVYHCVPPCDGLCKKNGGSSGSCSFLVP
SGLACWCKDLPDNVPIKDTSRKCT-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel