product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Agitoxin-1
catalog :
STA-150
more info or order :
citations: 1
image
image 1 :

Western blot analysis of rat dorsal root ganglion lysate (lanes 1 and 3) and rat brain membranes (lanes 2 and 4): - 1-2.Anti-pan ASIC (extracellular) Antibody (#ASC-031) (1:500).3-4. Anti-pan ASIC (extracellular) Antibody preincubated with the negative control antigen.
image 2 :

product information
cat :
STA-150
SKU :
STA-150_0.1 mg
Product Name :
Agitoxin-1
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P46110
Accession Number :
https://www.uniprot.org/uniprotkb/P46110/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Leiurus hebraeus (Hebrew deathstalker scorpion) (Leiurus quinquestriatus hebraeus)
Source :
Synthetic peptide
Gene ID :
KCNA1, KCNA3, KCNA6
Product Page - Scientific background :
Agitoxins are peptide toxins originally isolated from L. quinquestriatus hebraeus scorpion venoM This group of toxins blocks potassium (K⁺) channels and has a central role in the investigation and understanding of the physiological importance of K+ channels and their function in membrane biophysics1.Agitoxins 1, 2 and 3 have been isolated and characterized. Each toxin is comprised of 38 amino acids. They are highly homologous and differ only in the identity of the residues at positions 7, 15, 29 and 31.Agitoxins appear to be specific for the Shaker K+ channel of Drosophila melanogaster and many of the mammalian homologues of Shaker. Agitoxin-1 blocks the Shaker channel in a stoichiometry of one to one, it binds the channel site in the extracellular vestibule and prevents ion conduction by occluding the pore2.Using scorpion toxins for molecular dissection of ion channels has led to direct evidence that specific mutations can be correlated to changes in the propagation and conduction of electrical impulses in the body3.
Supplier :
Alomone Labs
Target :
KV1.3 channels
Long Description :
A Potent Blocker of KV1.3 Channels
Short Description :
A Potent Blocker of KV1.3 Channels
MW :
4015 Da
Synonyms :
K+ channel toxin α-KTx 3.4, Leiurotoxin-2, AgTx-1, AgTx1, Leiurotoxin II, LeTx II
Modifications :
Disulfide bonds between: Cys8-Cys28, Cys14-Cys33, and Cys18-Cys35
Molecular formula :
C169H278N52O47S7
Activity :
Agitoxin-1 is a blocker of Shaker voltage-gated K+ channels as well as the mammalian homologues of Shaker.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
155646-21-2
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
GVPINVKCTGSPQCLKPCKDAGMRFGKCINGKCHCTPK-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments