Aam-KTX | Alomone Labs STA-110 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Aam-KTX

catalog :

STA-110

more info or order :

Alomone Labs product webpage

image

image 1 :

Peptide (C)TRYGKELSMVKIPSK corresponding to amino acid residues 368-382 of rat ASIC1 (AccessionP55926) amino acid residues 367?381 of rat ASIC2 (AccessionQ62962) amino acid residues 375?388 of rat ASIC3 (AccessionO35240) and amino acid residues 378?390 of rat ASIC4 (AccessionQ9JHS6). Extracellular loop.

image 2 :

Alomone Labs Aam-KTX inhibits KV1.3 channel currents expressed in Xenopus oocytes. - A. Time course ofAam-KTX(#STA-110) action on KV1.3 channels current. Peak current amplitude recorded at +55 mV was plotted as a function of time. Membrane potential was held at -100 mV and oocytes were stimulated by a 100 ms voltage ramp to +60 mV. 0.5 nM Aam-KTX was perfused as indicated by the bar (green). B. Superimposed examples of KV1.3 channel current in the absence (control) and presence (green) of 0.50 nM Aam-KTX (taken from the experiment in A).

product information

cat :

STA-110

SKU :

STA-110_0.1 mg

Product Name :

Aam-KTX

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P0C8R1

Accession Number :

https://www.uniprot.org/uniprotkb/P0C8R1/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Androctonus amoreuxi (African fattail scorpion) (Scorpio amoreuxi)

Source :

Synthetic peptide

Gene ID :

KCNA2 ,KCNA3

Product Page - Scientific background :

KTxs are scorpion peptide toxins that act on voltage-gated K+ channels which can be divided into four groups: α, β, γ, and κ. Aam-KTX is an analogue of Kaliotoxin that originates from Androctonus amoreuxi scorpion venoM It contains a conserved α-helix/β-sheet structural motif composed of a single α-helix and one β-sheet of two antiparallel strands. KTxs primarily affects voltage-gated Shaker-related and ether-a-go-go-related gene (ERG) K+ channels and Ca2+-activated K+ channels of high, intermediate, or small conductance1,2. IC50 values of Aam-KTX for KV1.3 channel and KV1.2 are 1.1 ± 0.02 and 10.4 ± 1.5 nM, respectively1.Potassium channels are a large family of membrane proteins ubiquitously distributed in excitable and nonexcitable cells. These channels play a major role in different physiological processes1.

Supplier :

Alomone Labs

Target :

KV K+ channels

Long Description :

A Blocker of Voltage-Gated K+ channels

Short Description :

A Blocker of Voltage-Gated K+ channels

MW :

4185 Da

Synonyms :

Potassium channel toxin α-KTx 3.12, Kaliotoxin analog

Modifications :

Disulfide bonds between: Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35 K38 - C-terminal amidation.

Molecular formula :

C174H288N58O48S7

Effective Concentration :

0.1 - 1 nM

Activity :

Aam-KTX is a KV1.3 channel blocker1.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥99% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

GVEINVKCTGSHQCIKPCKDAGMRFGKCINRKCHCTPK-NH2

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage