product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Calcicludine
catalog :
SPC-650
more info or order :
image
image 1 :
Alomone Labs SPC-650 image 1
product information
cat :
SPC-650
SKU :
SPC-650_0.25 mg
Product Name :
Calcicludine
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P81658
Accession Number :
https://www.uniprot.org/uniprotkb/P81658/entry#names_and_taxonomy
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Dendroaspis angusticeps (Eastern green mamba)
Source :
Synthetic protein
Gene ID :
CACNA1A,CACNA1B,CACNA1C,CACNA1D,CACNA1F,CACNA1S
Product Page - Scientific background :
Calcicludine is a natural peptide isolated from the Dendroaspis angusticeps green mamba venom by a modification to the procedure of Schweitz et al.1 and purified to homogenity.Calcicludine was shown to be a specific neuronal L-type CaV channel blocker and was shown to inhibit other neuronal HVA CaV channels (N- and P-type) as well.1 1 µM Calcicludine had no effect on skeletal muscle CaV channels (CaV1.1) as well as on T-type (CaV3) channels in heart and neurons.1 Calcicludine was tested to confirm its ability to block spontaneous or K+-induced contraction of cardiac cells.1 It blocked CaV1.2 cloned channels with an IC50 of 88 nM and had very little effect on CaV2 family channels.2 In addition, the block was irreversible upon wash and never complete but reached a maximum of 58%.
Supplier :
Alomone Labs
Target :
L-type Ca2+ channels
Long Description :
A Blocker of Neuronal L-Type CaV Channels
Short Description :
A Blocker of Neuronal L-Type CaV Channels
MW :
6980 Da
Synonyms :
CAC
Modifications :
Disulfide bonds between: Cys7-Cys57, Cys16-Cys40 and Cys32-Cys53
Molecular formula :
C321H476N86O78S6
Effective Concentration :
500 nM
Activity :
Calcicludine is a potent and specific antagonist of neuronal L-type CaV channels1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
178037-96-2
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSG
CGGNANRFQTIGECRKKCLGK-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel