product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Calciseptine
catalog :
SPC-500
more info or order :
citations: 5
Reference |
---|
image
image 1 :

product information
cat :
SPC-500
SKU :
SPC-500_0.25 mg
Product Name :
Calciseptine
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P22947
Accession Number :
https://www.uniprot.org/uniprotkb/P22947/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Dendroaspis polylepis polylepis (Black mamba)
Source :
Synthetic protein
Gene ID :
CACNA1C
Product Page - Scientific background :
Calciseptine is a peptide toxin originally isolated from black mamba (Dendroaspis polylepsis) venom (1, 2). A three-finger toxin, calciseptine consists of 60 amino acids with 4 disulfide bridges (2). It is a specific L-type CaV channel blocker selective for CaV1.2 (3). Calciseptine binds to the shoulder of the CaV1.2 pore domain and traps the channel in a non-conductive conformation (4).Calciseptine blocks spontaneous or K+-induced contraction of cardiac and smooth muscle cells (2). However, in skeletal muscle, it increases L-type currents, modulating Ca2+ permeation (5). Using a patch clamp, calciseptine was shown to specifically block L-type CaV channel currents in neuronal cells in culture, with IC50 values of 15-500 nM (2). It was also shown to reduce the open probability and availability of the L-type channel in guinea pig portal vein smooth muscle cells, using outside-out patch clamping (6).CaV1.2 is one of 10 voltage-gated calcium channels (VGCCs), which are divided into three families based on the pore-forming α1 subunit (7); they were originally divided based on activation voltage current (8). Encoded by the CACNA1C gene, CaV1.2 consists of the three subunits α1, a2δ, and β. This channel is expressed by smooth and cardiac muscle, pancreas, neurons, and fibroblasts. It is involved in central nervous system function and neuroendocrine regulation, cardiac and smooth muscle contractibility, and multiple other physiological processes (9).
Supplier :
Alomone Labs
Target :
L-type Ca2+ channels
Long Description :
A Specific Blocker of L-Type CaV Channels
Short Description :
A Specific Blocker of L-Type CaV Channels
MW :
7036 Da
Synonyms :
CaS, Calciseptin
Modifications :
Disulfide bonds between: Cys3-Cys22, Cys17-Cys39, Cys41-Cys52 and Cys53-Cys58
Molecular formula :
C299H468N90O87S10
Effective Concentration :
500 nM
Activity :
Calciseptine is a specific antagonist of L-type CaV channels1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
178805-91-9
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
RICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGC
GCPTAMWPYQTECCKGDRCNK-OH
GCPTAMWPYQTECCKGDRCNK-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments