product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
SNX-482
catalog :
RTS-500
more info or order :
citations: 44
Reference |
---|
Woodhall G, Ayman G, Jones R. Differential control of two forms of glutamate release by group III metabotropic glutamate receptors at rat entorhinal synapses. Neuroscience. 2007;148:7-21 pubmed
|
image
image 1 :

Alomone Labs SNX-482 inhibits CaV2.3 channels heterologously expressed inXenopusoocytes. - CaV2.3 channel subunits co-expressed inXenopusoocytes. Using TEVC membrane potential was held at -100 mV. Ba2+(10 mM) currents via CaV2.3 channels were elicited by 40 ms long voltage ramps from -100 to +60 mV delivered every 10 seconds. Left: Representative current traces before and following the application of 100 200 and 400 nMSNX-482(#RTS-500) as indicated. Right: Dose-response for SNX-482 (n = 2-6).
image 2 :

SNX-482 blocks KV4.3 currents heterologously expressed in HEK 293 cells. - Effect of 3 nM (top) and 60 nM (bottom)SNX-482(#RTS-500) on current carried by cloned KV4.3 channels expressed in HEK-293 cells (left panels). Effect of 3 nM (top) and 60 nM (bottom) SNX-482 on current carried by cloned CaV2.3 channels expressed in HEK-293 cells. Recordings at 23C.Adapted fromKimm T. and Bean B.P.(2014) with permission of the Society for Neuroscience.
product information
cat :
RTS-500
SKU :
RTS-500_0.1 mg
Product Name :
SNX-482
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P56854
Accession Number :
https://www.uniprot.org/uniprotkb/P56854/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Hysterocrates gigas (Cameroon red baboon tarantula)
Source :
Recombinant, E. coli
Gene ID :
CACNA1A, CACNA1E, KCND2, KCND3
Product Page - Scientific background :
SNX-482 is a peptidyl toxin originally isolated from venom of the spider Hysterocrates gigas. Native SNX-482 blocks specifically CaV2.3 (α1E, R-type) channels1 in a voltage-dependent manner. The block is reversible only upon application of strong voltage to facilitate unbinding.2 SNX-482 inhibits human CaV2.3 channels stably expressed in a mammalian cell line. An IC50 of 15-30 nM was obtained for block of CaV2.3 channel, using either patch clamp electrophysiology or K+-evoked Ca2+ flux. At low nanomolar concentrations, SNX-482 also blocked a native R-type Ca2+ current in rat neurohypophyseal nerve terminals, but concentrations of 200-500 nM had no effect on R-type Ca2+ currents in several types of rat central neurons.1 SNX-482 was also used to demonstrate the contribution of CaV2.3 channels to transmitter release.3 Recently it was shown that higher concentrations of SNX-482 also block CaV2.1 channels in chromaffin cells.4SNX-482 was found to be the most potent blocker to date for KV4.3 channel with IC50 < 3 nM5.
Supplier :
Alomone Labs
Target :
CaV2.3, CaV2.1, KV4.2, KV4.3 channels
Long Description :
A Blocker of CaV2.3 and KV4.3 Channels
Short Description :
A Blocker of CaV2.3 and KV4.3 Channels
MW :
4495 Da
Synonyms :
ω-Theraphotoxin-Hg1a, ω-TRTX-Hg1a, SNX 482
Modifications :
Disulfide bonds between: Cys7-Cys21, Cys14-Cys26, and Cys20-Cys33
Molecular formula :
C192H274N52O60S7
Effective Concentration :
10 - 100 nM
Activity :
SNX-482 blocks R-type (CaV2.3) and P/Q-type (CaV2.1) voltage-gated Ca2+ channels1. It also blocks A-type K+ channels with an IC50 < 3 nM2.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
203460-30-4
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTF
SD-OH
SD-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
Cited Application :
Electrophysiology
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments