product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Lq2
catalog :
RTL-550
more info or order :
product information
cat :
RTL-550
SKU :
RTL-550_0.1 mg
Product Name :
Lq2
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P45628
Accession Number :
https://www.uniprot.org/uniprotkb/P45628/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Leiurus hebraeus (Hebrew deathstalker scorpion) (Leiurus quinquestriatus hebraeus)
Source :
Recombinant, E. coli
Gene ID :
KCNJ1,KCNMA1
Product Page - Scientific background :
Lq2 was originally isolated from Leiurus quinquestriatus hebraeus scorpion venoM1Lq2 blocks Kir1.1 K+ inward rectifier channels (Ki of 410 nM).2In the planar lipid bilayer, it also blocked single KCa channels from rat muscle with intrinsic KD of 43 nM,1 by introducing brief closures. Lq2 action is on the extracellular side of the pore.
Supplier :
Alomone Labs
Target :
Kir1.1 K+ inward rectifier channels, KCa1.1 channels
Long Description :
A Potent Blocker of Kir1.1 (ROMK1) Channels
Short Description :
A Potent Blocker of Kir1.1 (ROMK1) Channels
MW :
4353 Da
Synonyms :
K+ channel toxin α-KTx 1.2, Charybdotoxin-2, ChTX-Lq2, ChTx-d, Toxin 18-2, Lqh 18-2
Modifications :
Disulfide bonds between: Cys7-Cys28, Cys13-Cys33 and Cys17-Cys35
Molecular formula :
C177H280N60O55S7
Effective Concentration :
0.1 - 10 nM
Activity :
Lq2 inhibits Kir1.1 K+ inward rectifier channels2, as well as KCa channels1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
QFTQESCTASNQCWSICKRLHNTNRGKCMNKKCRCYS-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel