product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Chlorotoxin
catalog :
RTC-450
more info or order :
citations: 10
| Reference |
|---|
Demillo V, Zhu X. Zwitterionic amphiphile coated magnetofluorescent nanoparticles - synthesis, characterization and tumor cell targeting. J Mater Chem B. 2015;3:8328-8336 pubmed
|
Chen S, Ahmadiantehrani M, Publicover N, Hunter K, Zhu X. Thermal Decomposition Based Synthesis of Ag-In-S/ZnS Quantum Dots and Their Chlorotoxin-Modified Micelles for Brain Tumor Cell Targeting. RSC Adv. 2015;74:60612-60620 pubmed
|
Asphahani F, Zheng X, Veiseh O, Thein M, Xu J, Ohuchi F, et al. Effects of electrode surface modification with chlorotoxin on patterning single glioma cells. Phys Chem Chem Phys. 2011;13:8953-60 pubmed
|
image
image 1 :

Alomone Labs Talampanel inhibits GluA1 channels expressed in Xenopus oocytes. - A. Time course of 100 and 300 ?MTalampanel(#T-185) reversible inhibitory action on glutamate elicited currents (100 ?M delivered every 100 seconds holding potential -80 mV). B. Superimposed current traces of control and inhibited current as indicated (taken from the experiment in A).
image 2 :

Alomone Labs Chlorotoxin inhibits Ca2+-activated Cl-currents. - Inhibition of Ca2+-activated Cl-currents byChlorotoxin(#RTC-450) in human R2 astrocyte cell line. The data are taken from three experiments and the calculated IC50was 68 nM.
product information
cat :
RTC-450
SKU :
RTC-450_0.1 mg
Product Name :
Chlorotoxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P45639
Accession Number :
https://www.uniprot.org/uniprotkb/P45639/entry
Applications :
Calcium imaging assay
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Leiurus quinquestriatus (scorpion)
Source :
Recombinant, E. coli
Gene ID :
CLCN3,MMP2, ANXA2
Product Page - Scientific background :
Native chlorotoxin (CTX) is a 36-amino acid peptide, originally isolated from the venom of the giant yellow Israeli scorpion Leiurus quinquestriatus hebraeus. Its primary amino acid sequence shows considerable homology to a class of short insectotoxins.1Initially, CTX was demonstrated as an irreversible inhibitor of small conductance Cl- channels in colonic epithelial cells and Cl- fluxes across glioma cell membranes.2,3 Inhibition of Cl- channels with CTX prevents cell volume changes, and in turn, inhibits tumor cell invasion and migration.4-6Immunohistochemical studies show that CTX specifically and selectively binds to glioma cell lines and to tissue biopsies from patients with various malignant gliomas and other embryonic related tumors of neuroectodermal origin but not to normal brain tissue.These findings have lead to clinical evaluation for the therapeutic and diagnostic use of CTX, a synthetic derivate, in patients with malignant glioma. This derivative of CTX has been shown to selectively label human gliomas in vivo and in vitro and demonstrated all of the known physical and biological activities of the naturally occurring CTX.7,8Further studies on the interaction of CTX with Cl- channels suggest that these effects are indirect; affinity purification with a recombinant CTX identified the matrix metalloproteinase-2 (MMP2) as a CTX binder in glioma cells. The actual receptor for CTX appears to be a protein complex that contains MMP2 and Cl- channel 3 (ClC-3). Binding of CTX induces endocytosis of this complex and hence the ClC-3 channels. This finding might explain the irreversible action of CTX and its relatively slow time course of Cl- channel blockage.9,10
Supplier :
Alomone Labs
Target :
Chloride channels, MMP-2, and annexin 2
Long Description :
An Inhibitor of Chloride Channels
Short Description :
An Inhibitor of Chloride Channels
MW :
3996.7 Da
Synonyms :
CTX, Cltx
Modifications :
Disulfide bonds between: Cys2-Cys19, Cys5-Cys28, Cys16- Cys33 and Cys20-Cys35
Molecular formula :
C158H248N52O48S11
Effective Concentration :
50 - 600 nM
Activity :
Chlorotoxin blocks small conductance Cl- channels of epithelial cells and also blocks Cl- channels expressed in gliomas1,2.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
163515-35-3
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments
