product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Agitoxin-2-Cys-TAMRA
catalog :
RTA-420-T
more info or order :
citations: 1
image
image 1 :

Alomone Labs Agitoxin-2-Cys-TAMRA labels KV1.3 expressing HEK-293 cells. - Confocal image of KV1.3 expressing HEK-293 cells labeled with a fluorescent Agitoxin-2-Cys-TAMRA (#RTA-420-T). KV1.3 expressing HEK-293 cells were grown on glass cover-slips incubated in the presence of 50 nM Agitoxin-2-Cys-TAMRA for 30 minutes at room temperature and washed with PBS. Left: Bright light field image of the cells. Middle: Image acquired with a Rhodamine filter. Right: Merge of both images. As can be seen Agitoxin-2-Cys-TAMRA is localized with the membrane-anchored KV1.3 K+ channel.We would like to thank Mr. Vladimir Kiss and Dr. Noga Alagem from the Weizmann Institute of Science for their help with the confocal microscope images.
image 2 :

Alomone Labs Agtitoxin-2-Cys-TAMRA binds to HEK-293 cells stably expressing KV1.3 channels. - Top: Staining of HEK-293 cells stably expressing KV1.3 channels with 50 nM ofAgitoxin-2-Cys-TAMRA(#RTA-420-T). Cells were incubated for 30 minutes with the fluorescent toxin washed with PBS and visualized. In the middle section the image acquired with a Rhodamine filter is shown and on the right it is merged with the bright light image of the same field to illustrate cellular staining. Middle: Displacement of labeled toxin byAgitoxin-2(#STA-420). The same preparation as the one shown on top was pre-incubated for 30 minutes with 10 M of Agitoxin-2 followed by 30 minute incubation after the addition of 50 nM Agitoxin-2-Cys-TAMRA. Bottom: Agitoxin-2-Cys-TAMRA does not stain non-transfected HEK-293 cells.
image 3 :

product information
cat :
RTA-420-T
SKU :
RTA-420-T_1 mcg
Product Name :
Agitoxin-2-Cys-TAMRA
Group Type :
Non Antibodies
Product Type :
Proteins
Applications :
Electrophysiology, Fluorescence staining
Formulation :
Lyophilized Powder.
Storage After Reconstitution :
Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water to high-micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water to high-micromolar concentrations (50 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Leiurus hebraeus (Hebrew deathstalker scorpion) (Leiurus quinquestriatus hebraeus)
Source :
Modified recombinant protein, E. coli
Gene ID :
KCNA1, KCNA2, KCNA3, KCNA6
Product Page - Scientific background :
Native Agitoxin-2 was originally isolated from the venom of the Israeli scorpion L. quinquestriatus hebraeus.1 Agitoxin-2 inhibits the native KV1.3-like current in cultured microglia and KV1.3 in MLS-9 cells.2 Agitoxin-2 is a potent blocker of the Shaker voltage-gated K+-channels as well as the mammalian homologues of Shaker.1A few recombinant, mutated and labeled toxins have been described in the literature, including the KCa1.1 specific blocker Iberiotoxin (#STI-400) and the KV1 blocker Hongotoxin (#RTH-400).3-4A similar approach was taken by Alomone Labs in producing Agitoxin-2-Cys-TAMRA. A fluorescent dye is attached to a free Cys residue, which replaces Asp in position 20 of the 38 amino acid long peptide. This novel toxin retains the blocking activity of the original toxin and specifically labels living cells expressing KV1.3 channels.
Supplier :
Alomone Labs
Target :
KV1.3 K+ channels
Long Description :
A Novel Marker of KV1.3 K+ Channels
Short Description :
A Novel Marker of KV1.3 K+ Channels
MW :
4673 Da
Synonyms :
K+ channel toxin α-KTx 3.2, AgTx-2, AgTx2
Modifications :
Disulfide bonds between: Cys8-Cys28, Cys14-Cys33, and Cys18-Cys35 Asp20 mutated to a Cys residue (indicated in bold) which was reacted with 5(6)-TAMRA-C5-maleimide.
Molecular formula :
C202H316N58O51S9
Effective Concentration :
50 pM - 10 nM
Activity :
Agitoxin-2 is a blocker of Shaker voltage-gated K+ channels as well as the mammalian homologues of Shaker. Agitoxin-2-Cys-TAMRA inhibits KV1.3 channels as potently.
Storage of solutions :
Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
GVPINVSCTGSPQCIKPCKCAGMRFGKCMNRKCHCTPK-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments