product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Aa1 Toxin
catalog :
RTA-400
more info or order :
image
image 1 :
Alomone Labs RTA-400 image 1
Alomone Labs Aa1 Toxin inhibits Shaker-B channels expressed in Xenopus oocytes. - Left: Current responses to 100 ms depolarization to 0 mV from holding potential of -100 mV delivered every 10 seconds before (red) and during (green) application of 1 MAa1 Toxin(#RTA-400). Right: Time course of amplitude inhibition.
product information
cat :
RTA-400
SKU :
RTA-400_0.1 mg
Product Name :
Aa1 Toxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
Q867F4
Accession Number :
https://www.uniprot.org/uniprotkb/Q867F4/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Androctonus australis (Sahara scorpion)
Source :
Recombinant, E. coli
Gene ID :
KCNA4, KCND1, KCND2, KCND3
Product Page - Scientific background :
Native Aa1 was originally isolated from Androctonus australis scorpion venoM Aa1 blocks Shaker B channels expressed in Xenopus oocytes with IC50=4.5 µM1 In addition, the Aa1 toxin was shown to block the fast (A-type) K+ current in cerebellum granular cells (IC 50 =134 nM,2 or Kd = 150 nM3). In both cases the block is non-voltage-dependent and does not affect kinetic parameters of the K+ currents.
Supplier :
Alomone Labs
Target :
A-type KV4 K+ channels
Long Description :
A Novel Blocker of Shaker-B and IA K+ Channels
Short Description :
A Novel Blocker of Shaker-B and IA K+ Channels
MW :
3868 Da
Synonyms :
K+ channel toxin α-KTx 15.4, AaTX1
Modifications :
Disulfide bonds between: Cys8-Cys28, Cys13-Cys33, and Cys17-Cys35
Molecular formula :
C156H260N54O49S6
Effective Concentration :
100 nM - 1 µM
Activity :
Aa1 Toxin is a blocker of A-type voltage-gated transient K+ channels of cerebellar granular cells1,2.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
QNETNKKCQGGSCASVCRRVIGVAAGKCINGRCVCYP-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel