chemical

Recombinant human Artemin protein

RPA-100

RPA-100_0.1 mg

Recombinant human Artemin protein

Non Antibodies

Proteins

Q5T4W7

https://www.uniprot.org/uniprotkb/Q5T4W7/entry

Western blot

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeated freeze-thaw cycles may result in loss of activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeat freeze-thawing may result in loss of activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Recombinant, E. coli

GFRA3

Artemin (ART), also named enovin and neublastin, is a neurotrophic factor that is crucial for the proper development of the sympathetic nervous systeM ART belongs to the glial cell line-derived neurotrophic factor (GDNF) family of ligands, which also includes GDNF, neurturin (NRTN), and persephin (PSPN). Artemin mRNA is expressed in many human adult and fetal tissues and in rat Schwann cells. Artemin's activity is mediated by a receptor complex composed of a receptor tyrosine kinase signaling component, RET, which is common for all GFLs, and a specific anchored membrane protein, GFRα3. Experimental studies have suggested that artemin supports the survival of cultured neurons from the dorsal root, trigeminal, nodose, and superior cervical ganglia and that it affects neurite outgrowth from the dorsal root and sympathetic ganglia of murine embryos. Recent investigations have reported that systemic artemin prevents and reverses neuropathic pain1.

Alomone Labs

GFRa3

Human Artemin, Recombinant, E. coli

Human Artemin, Recombinant, E. coli

23.9 kDa (dimer)

Enovin, Neublastin

Inter-chain disulfide bonds between Cys16-Cys81, Cys43-Cys109, Cys47-Cys111 and intra-chain disulfide bond between Cys80 of two hArtemin molecules.

0.1 - 10 nM

Artemin supports the survival of different peripheral neurons and dopaminergic midbrain neurons both in vitro and in vivo. In addition, it supports motor neurons in culture1-3.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

AGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVR
FRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQ
PCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG

No

12352202

yes

yes