product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Recombinant human Persephin protein
catalog :
P-320
more info or order :
image
image 1 :

Expression of KCNK2(TREK-1) in rat midbrain - Immunohistochemical staining of perfusion-fixed frozen rat brain sectionsusing Guinea pigAnti-KCNK2(TREK-1) Antibody (#AGP-049) (1:400) followed by goat-anti-guinea pig-Cy3 antibody. TREK-1 staining (red) appears in neurons in the rat lateral substantia nigra (arrows). Nuclei are stained with DAPI (blue).
product information
cat :
P-320
SKU :
P-320_10 mcg
Product Name :
Recombinant human Persephin protein
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
O60542
Accession Number :
https://www.uniprot.org/uniprotkb/O60542/entry#sequences
Formulation :
Lyophilized in PBS.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Source :
Recombinant, E. coli
Gene ID :
GFRA4
Product Page - Scientific background :
Persephin is a novel neurotrophic factor related to GDNF and Neurturin in the GDNF subfamily.1 Persephin is ubiquitously expressed, although at very low levels.2In sharp contrast to GDNF and Neurturin, Persephin does not support the survival of neurons from peripheral ganglia including sympathetic and parasympathetic neurons, sensory neurons and enteric neurons.1,3 Persephin does promote the survival of midbrain dopaminergic neurons after neurotoxic injury and the survival of spinal motor neurons in vitro and in vivo animal models.The receptor for Persephin is a multi-component complex composed of RET tyrosine kinase and the glycosyl-phosphatidylinositol (GPI)-anchored co-receptor GFRalpha1-alpha4.4,5Persephin induces, in vitro, branching of the ureteric bud of the kidney, an activity shared by Neurturin and GDNF.1 Both in vitro and in vivo experiments using animal models suggest that Persephin could be useful in the treatment of neurodegenerative diseases including Parkinson's disease and Amyotrophic Lateral Sclerosis (ALS).6
Supplier :
Alomone Labs
Target :
GFRa4
Long Description :
Human Persephin, Recombinant, E. coli
Short Description :
Human Persephin, Recombinant, E. coli
MW :
20.6 kDa (dimer)
Synonyms :
PSP
Activity :
Persephin promotes the survival of mesencephalic, dopaminergic and motor neurons1,2. The receptor for Persephin is a multicomponent complex composed of RET tyrosine kinase and the glycosyl-phosphatidylinositol (GPI)-anchored co-receptor GFR α1-α43,4.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
ALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPR
GARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDR
HRWQRLPQLSAAACGCGG
GARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDR
HRWQRLPQLSAAACGCGG
Is Toxin :
No
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments
