chemical

Pardaxin

P-300

P-300_0.35 mg

Pardaxin

Non Antibodies

Proteins

P81862

https://www.uniprot.org/uniprotkb/P81862/entry

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Pardachirus marmoratus (Finless sole) (Achirus marmoratus).

Natural peptide

Pardaxin is a 33 amino acid peptidyl toxin, produced by the Red Sea Moses sole fish Pardachirus marmoratus. Pardaxin is acidic, amphipathic, and hydrophobic that forms voltage-dependent pore channels in liposomes and planar lipid bilayers and living cells2.The toxin exhibits a neurotoxic, excitatory activity toward neurons at subcytotoxic concentrations by both Ca2+-dependent and Ca2+-independent mechanisms. Pardaxin also causes hemolysis, reduction of blood pressure, cell death by necrosis, and is lethal to rats at higher concentrations3.

Alomone Labs

An Inducer of Neurotransmitter Release

An Inducer of Neurotransmitter Release

3382 Da

Pardaxin P-5, Pardaxin Pa5, Pardaxin P5

C156H250N36O47

1 - 10 µM

Pardaxin forms ion channel-like structures at low concentrations and at high concentrations, causes cell membrane lysis1,2. Pardaxin also induces neurotransmitter release from neurons3,4.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

67995-63-5

Lyophilized

Contact Alomone Labs for technical support and product customization

GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE-OH

Yes

12352202

no