chemical

BomoTx Toxin

NTB-200

NTB-200_0.14 mg

BomoTx Toxin

Non Antibodies

Proteins

A0A1S5XW05

https://www.uniprot.org/uniprotkb/A0A1S5XW05/entry

Electrophysiology

Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Bothrops moojeni (Brazilian lancehead pit viper)

Natural protein

P2RX2,P2RX3

BomoTx belongs to a group of secreted phospholipase A2 (sPLA2)-like protein toxins originally isolated from the Brazilian lancehead pit viper (Bothrops moojeni). This toxin contains a conserved PLA2 fold but lacks enzymatic activity. BomoTx is mostly related to Lys49 myotoxins found in snake species within the Crotalinae subfamily1.BomoTx functions by activating a subpopulation of somatosensory neurons that contribute to pain sensation. BomoTx excites these neurons by stimulating the release of cellular ATP through a mechanism involving pannexin hemichannels resulting in activation of P2X2 and P2X3 purinergic receptors. Injection of BomoTx to mouse hind paw causes non-neurogenic inflammatory pain, thermal hyperalgesia, and mechanical allodynia.P2X receptors are cationic trimeric channel complexes that function as ATP-gated calcium-permeable channels and are attractive therapeutic targets. This family contains seven receptor subtypes: P2X1-P2X72.

Alomone Labs

P2X2/P2X3 receptors

A Somatosensory, Pain Inducing Neuron Stimulator, Indirect P2X2/P2X3 Receptor Agonist

A Somatosensory, Pain Inducing Neuron Stimulator, Indirect P2X2/P2X3 Receptor Agonist

13834 Da

BomoToxin, Bomo Toxin, Myotoxin, Phospholipase A2 like protein, PLA2-like toxin

The exact location of the disulfide bridges is currently unknown.

C598H942N166O181S15

1 µM

BomoTx Toxin excites sensory neurons via ATP release and consequent activation of P2X2 and/or P2X3 receptors.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥99% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

SLVELGKMILQETGKNPVTSYGAYGCNCGVLGRGKPKDA
TDRCCYVHKCCYKKLTDCNPKKDRYSYSWKDKTIVCGEN
NSCLKELCECDKAVAICLRENLDTYNKKYKNNYLKPFCK
KADPC

Yes

12352202

no