product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
BomoTx Toxin
catalog :
NTB-200
more info or order :
citations: 1
Reference
Rodrigues A, Wang Z, Messi M, Delbono O. Sympathomimetics regulate neuromuscular junction transmission through TRPV1, P/Q- and N-type Ca2+ channels. Mol Cell Neurosci. 2019;95:59-70 pubmed publisher
product information
cat :
NTB-200
SKU :
NTB-200_0.14 mg
Product Name :
BomoTx Toxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
A0A1S5XW05
Accession Number :
https://www.uniprot.org/uniprotkb/A0A1S5XW05/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Bothrops moojeni (Brazilian lancehead pit viper)
Source :
Natural protein
Gene ID :
P2RX2,P2RX3
Product Page - Scientific background :
BomoTx belongs to a group of secreted phospholipase A2 (sPLA2)-like protein toxins originally isolated from the Brazilian lancehead pit viper (Bothrops moojeni). This toxin contains a conserved PLA2 fold but lacks enzymatic activity. BomoTx is mostly related to Lys49 myotoxins found in snake species within the Crotalinae subfamily1.BomoTx functions by activating a subpopulation of somatosensory neurons that contribute to pain sensation. BomoTx excites these neurons by stimulating the release of cellular ATP through a mechanism involving pannexin hemichannels resulting in activation of P2X2 and P2X3 purinergic receptors. Injection of BomoTx to mouse hind paw causes non-neurogenic inflammatory pain, thermal hyperalgesia, and mechanical allodynia.P2X receptors are cationic trimeric channel complexes that function as ATP-gated calcium-permeable channels and are attractive therapeutic targets. This family contains seven receptor subtypes: P2X1-P2X72.
Supplier :
Alomone Labs
Target :
P2X2/P2X3 receptors
Long Description :
A Somatosensory, Pain Inducing Neuron Stimulator, Indirect P2X2/P2X3 Receptor Agonist
Short Description :
A Somatosensory, Pain Inducing Neuron Stimulator, Indirect P2X2/P2X3 Receptor Agonist
MW :
13834 Da
Synonyms :
BomoToxin, Bomo Toxin, Myotoxin, Phospholipase A2 like protein, PLA2-like toxin
Modifications :
The exact location of the disulfide bridges is currently unknown.
Molecular formula :
C598H942N166O181S15
Effective Concentration :
1 µM
Activity :
BomoTx Toxin excites sensory neurons via ATP release and consequent activation of P2X2 and/or P2X3 receptors.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥99% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
SLVELGKMILQETGKNPVTSYGAYGCNCGVLGRGKPKDA
TDRCCYVHKCCYKKLTDCNPKKDRYSYSWKDKTIVCGEN
NSCLKELCECDKAVAICLRENLDTYNKKYKNNYLKPFCK
KADPC
Is Toxin :
Yes
UNSPSC :
12352202
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel