chemical

Recombinant human NGF proDomain protein

N-290

N-290_10 mcg

Recombinant human NGF proDomain protein

Non Antibodies

Proteins

Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeated freeze-thaw cycles may result in loss of activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeat freeze-thawing may result in loss of activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Recombinant, E. coli

NGFR, NTRK1, SORT1, SORCS2

NGF is a key factor in the survival and differentiation of neurons in the peripheral and central nervous systems. Like many other neurotrophins, mature NGF arises from the proteolytic cleavage of its precursor form (proNGF) by various proteases. It has been found that proNGF, and not mature NGF, is the predominant isoform found in the human brain as well as in a variety of cell types, including mast cells, sciatic nerve cells, thyroid gland, skeletal muscle, prostate gland, hippocampus and hair follicle.4 The mouse salivary gland is the most abundant source of mature NGF. NGF can be secreted as proNGF or mature NGF, each with distinct binding preferences for p75NTR, Trk-family receptors and sortilin.1-3In many cases, the full prodomain region derived from the precursor has biological functions, for instance; the prodomain of the transforming growth factor β (TGFβ) affects the dimerization and folding as well as the activity of the mature proteins via non-covalent association. The propeptide of the bone morphogenetic proteins BMP-4 and BMP-7 regulates the diffusion and distribution of these growth factors within the extracellular matrix.4,5 However, the role of the full NGF-prodomain, which is a proteolytic cleavage product of the proNGF, is not clearly understood. This region has been reported to give rise to several bioactive peptides that promote cell survival, probably through activation of Trk receptor pathway.6 Furthermore, binding competition studies suggest that binding sites for NGF prodomain and BDNF prodomain are located in the tunnel of the ten-bladed β-propeller domain of sortilin.7,8

Alomone Labs

Human NGF proDomain, Recombinant, E. coli

Human NGF proDomain, Recombinant, E. coli

11.6 kDa

proNGF is the preferred ligand of p75NTR 1. In contrast to its mature form proNGF induces apoptosis via p75NTR 1, but can also mediate cell survival in DRGs2.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPA
AAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPR
EAADTQDLDFEVGGAAPFNRTHRSKR

No

12352202

yes