product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Recombinant human Neurotrophin-4 (NT-4) protein
catalog :
N-270
more info or order :
citations: 2
Reference
Jablonski A, Lamitina T, Liachko N, Sabatella M, Lu J, Zhang L, et al. Loss of RAD-23 Protects Against Models of Motor Neuron Disease by Enhancing Mutant Protein Clearance. J Neurosci. 2015;35:14286-306 pubmed publisher
Zhai J, Zhang L, Mojsilovic Petrovic J, Jian X, Thomas J, Homma K, et al. Inhibition of Cytohesins Protects against Genetic Models of Motor Neuron Disease. J Neurosci. 2015;35:9088-105 pubmed publisher
image
image 1 :
Alomone Labs N-270 image 1
Alomone Labs Recombinant human Neurotrophin-4 (NT-4) protein induces activation of ERK1/2 MAPK in TrkB transfected HEK-293 cells. - Cells were serum starved for 2 h preincubated with or without 200 nMK252a(#K-150) as indicated and then stimulated with various concentrations of Recombinanthuman Neurotrophin-4 (NT-4) protein(#N-270). Cell proteins were resolved by SDS-PAGE and probed with anti-phospho-ERK1/2.
image 2 :
Alomone Labs N-270 image 2
product information
cat :
N-270
SKU :
N-270_0.1 mg
Product Name :
Recombinant human Neurotrophin-4 (NT-4) protein
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P34130
Accession Number :
https://www.uniprot.org/uniprotkb/P34130/entry
Applications :
Western blot
Formulation :
Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Source :
Recombinant, E. coli
Gene ID :
NTRK2, NGFR
Product Page - Scientific background :
The neurotrophins ("neuro" means nerve and "trophe" means nutrient) are a family of soluble, basic growth factors which regulate neuronal development, maintenance, survival and death in the CNS and PNS.1Neurotrophin-4 (NT-4) is expressed in neurons of the superior cervical, stellate and celiac ganglion,2 T-cells3 and is synthesized by keratinocytes.4The structural hallmark of all the neurotrophins is the characteristic arrangement of the disulfide bridges known as the cysteine knot, which has been found in other growth factors such as PDGF.5The rat and human forms of NT-4 are 96% homologous. NT-4 has been shown to promote dendritic outgrowth and calcium currents in cultured mesencephalic dopamine neurons,6 to promote growth and remodeling of adult motor neuron innervation,7 to be anterograde survival factors for postsynaptic cells8 and to protect against apoptotic neuronal death.9The biological effects of NT-4 are mediated by two receptors: TrkB which is specific for NT-4 and BDNF, and p75NTR which binds all the neurotrophins.10
Supplier :
Alomone Labs
Target :
p75NTR, TrkB receptors
Long Description :
Human Neurotrophin-4, Recombinant, E. coli
Short Description :
Human Neurotrophin-4, Recombinant, E. coli
MW :
28.1 kDa (dimer)
Synonyms :
Neutrophic factor 4, NT-4, Neurotrophin-5 (NT-5)
Effective Concentration :
1 - 10 ng/ml
Activity :
NT-4 is involved in many biological outcomes including promoting dendritic outgrowth and Ca2+ currents in cultured mesencephalic dopamine neurons1, promoting growth and remodeling of adult motor neuron innervation2. The biological effects of NT-4 are mediated by two receptors: TrkB which is specific for NT-4 and BDNF, and p75NTR which binds all the neurotrophins3.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREV
EVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGG
CRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRID
TACVCTLLSRTGRA
Is Toxin :
No
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
yes
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel