product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Recombinant human beta-NGF protein
catalog :
N-245
more info or order :
citations: 6
Reference |
---|
image
image 1 :

Alomone Labs Recombinant human beta-NGF protein promotes survival of PC12 cells. - Cells were grown in the absence of serum and collagen and in the presence of varying concentrations of Recombinanthuman beta-NGF protein(#N-245). Cell survival relative to the control was measured by the XTT method and plotted against Recombinant human beta-NGF protein concentration.
image 2 :

Alomone Labs Recombinant human beta-NGF protein promotes neurite outgrowth in PC12 cells. - Cells were grown on collagen coated 24 well plates in DMEM medium supplemented with 6% fetal calf serum and 6% horse serum for 24 h. Recombinanthuman beta-NGF protein(#N-245) was added at the indicated concentrations. The culture media was changed every 2-3 days. The development of neurites over a period of 5 days was visualized by Methylene Blue staining.
image 3 :

Western blot analysis of rat brain membranes (lanes 1 and 3) and mouse brain synaptosomal fraction (lanes 2 and 4): - 12.Anti-Neuropilin-2 (NRP2) (extracellular) Antibody(#ANR-062) (1:200).34. Anti-Neuropilin-2 (NRP2) (extracellular) Antibody preincubated with the negative control antigen.
product information
cat :
N-245
SKU :
N-245_0.1 mg
Product Name :
Recombinant human beta-NGF protein
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P01138
Accession Number :
https://www.uniprot.org/uniprotkb/P01138/entry
Applications :
Neurite outgrowth assay, Cell survival assay
Formulation :
Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeated freeze-thaw cycles may result in loss of activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeat freeze-thawing may result in loss of activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Source :
Recombinant, E. coli
Gene ID :
NGFR, NTRK1
Product Page - Scientific background :
The neurotrophins ("neuro" means nerve and "trophe" means nutrient) are a family of soluble, basic growth factors which regulate neuronal development, maintenance, survival and death in the CNS and PNS.1 NGF, the first member of the family to be discovered, was originally purified as a factor able to support survival of sympathetic and sensory spinal neurons in culture.2 It is synthesized and secreted by sympathetic and sensory target organs and provides trophic support to neurons as they reach their final target.3Neurotrophin secretion increases in the nervous system following injury. Schwann cells, fibroblasts, and activated mast cells normally synthesize NGF constitutively, however direct trauma and induction of cytokines combine to increase neurotrophin production in these cells after injury.4The structural hallmark of all the neurotrophins is the characteristic arrangement of the disulfide bridges known as the cysteine knot, which has been found in other growth factors such as Platelet-derived growth factor.5 There is a 95.8% homology between the rat and mouse forms, and an 85% homology between the human and mouse.NGF has been shown to regulate neuronal survival, development, function and plasticity.6 Recently, involvement of NGF in processes not involving neuronal cells has been shown, such as asthma,7 psoriasis8 and wound healing.9 The biological effects of NGF are mediated by two receptors: TrkA, which is specific for NGF, and p75NTR, which binds all the neurotrophins.10
Supplier :
Alomone Labs
Target :
p75NTR, TrkA receptors
Long Description :
Human β-Nerve Growth Factor, Recombinant, E. coli
Short Description :
Human β-Nerve Growth Factor, Recombinant, E. coli
MW :
27 kDa (dimer)
Synonyms :
β-Nerve Growth Factor
Effective Concentration :
EC50 = 0.4 nM
Activity :
NGF is purified in three forms: the 7S, 2.5S and β. The biologically active subunit is the β, which is a 26 kDa. dimer composed of two identical chains held together by hydrophobic interactions1. NGF has been shown to regulate neuronal survival, development, function and plasticity2.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVL
GEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNS
YCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAV
RRA
GEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNS
YCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAV
RRA
Is Toxin :
No
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
yes
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel