Muscarinic Toxin 3 | Alomone Labs M-140 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Muscarinic Toxin 3

catalog :

M-140

more info or order :

Alomone Labs product webpage

citations: 4

Reference
Nadal L, Garcia N, Hurtado E, Simó A, Tomas M, Lanuza M, et al. Presynaptic Muscarinic Acetylcholine Receptors and TrkB Receptor Cooperate in the Elimination of Redundant Motor Nerve Terminals during Development. Front Aging Neurosci. 2017;9:24 pubmed publisher
Nadal L, Garcia N, Hurtado E, Simó A, Tomas M, Lanuza M, et al. Presynaptic muscarinic acetylcholine autoreceptors (M1, M2 and M4 subtypes), adenosine receptors (A1 and A2A) and tropomyosin-related kinase B receptor (TrkB) modulate the developmental synapse elimination process at the neuromuscular junction. Mol Brain. 2016;9:67 pubmed publisher
HernÃ¡ndez MartÃnez R, Aceves J, Rueda Orozco P, HernÃ¡ndez Flores T, HernÃ¡ndez GonzÃ¡lez O, Tapia D, et al. Muscarinic presynaptic modulation in GABAergic pallidal synapses of the rat. J Neurophysiol. 2015;113:796-807 pubmed publisher
Yaron Jakoubovitch A, Jacobson G, Koch C, Segev I, Yarom Y. A paradoxical isopotentiality: a spatially uniform noise spectrum in neocortical pyramidal cells. Front Cell Neurosci. 2008;2:3 pubmed publisher

image

image 1 :

Alomone LabsMuscarinic Toxin 3inhibits Muscarinic Receptor 4 expressed in CHO-K1 cells. - CHO-K1 cells were co-transfected with human M4 and G?15in order to couple the M4 receptor to the Ca2+signaling pathway. Ca2+concentrations were monitored using FLIPR. Cells were first incubated in the presence of different concentrations ofMuscarinic Toxin 3(#M-140) followed by Oxotremorine. The percentage of M4 receptor inhibition was plotted versus different concentrations of Muscarinic Toxin 3. The IC50value of Muscarinic Toxin 3 was between 100 to 1000 nM.

product information

cat :

M-140

SKU :

M-140_0.1 mg

Product Name :

Muscarinic Toxin 3

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P81031

Accession Number :

https://www.uniprot.org/uniprotkb/P81031/entry

Applications :

Calcium imaging assay

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Dendroaspis angusticeps (Eastern green mamba).

Source :

Natural protein

Gene ID :

ADRA1A,ADRA1B,ADRA1D,ADRA2A,ADRA2C,CHRM1,CHRM4

Product Page - Scientific background :

Muscarinic toxins are isolated from the venom of the mamba species and are composed of 65 to 66 amino acid residues with four intramolecular disulfide bridges. One of these is muscarinic toxin 3 (MT-3) which was isolated from the green mamba (Dendroaspis augusticeps) and is composed of 65 amino acid residues1. A recent study investigated the interaction of MT3 with cloned receptors (mAChRs and adrenoceptors) expressed in insect cells by radioligand binding. MT3 appears to have a broad spectrum of targets showing high-affinity binding (IC50 = 1-10 nM) to M4 mAChR, α1A-, α1D- and α2A-adrenoceptors and lower affinity binding (IC50 > 25 nM) to α1B- and α2C-adrenoceptors and M1 mAChR2.

Supplier :

Alomone Labs

Target :

M1, M4 muscarinic receptors, adrenoceptors

Long Description :

An Antagonist of M1 and M4 Muscarinic Receptors and Adrenoceptors

Short Description :

An Antagonist of M1 and M4 Muscarinic Receptors and Adrenoceptors

MW :

7379 Da

Synonyms :

MT3, MT-3

Modifications :

Disulfide bonds between: Cys3-Cys24, Cys17-Cys42, Cys46-Cys57and Cys58-Cys63

Molecular formula :

C319H489N89O97S8

Effective Concentration :

100 nM - 1 μM

Activity :

Muscarinic receptor 4 and adrenoceptor antagonist1-4.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

>99% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

LTCVTKNTIFGITTENCPAGQNLCFKRWHYVIPRYTEIT
RGCAATCPIPENYDSIHCCKTDKCNE-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage