product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
MitTx Toxin
catalog :
M-100
more info or order :
citations: 4
Reference
Wu Y, Chen Z, Sigworth F, Canessa C. Structure and analysis of nanobody binding to the human ASIC1a ion channel. elife. 2021;10: pubmed publisher
BARTH D, Fronius M. Shear force modulates the activity of acid-sensing ion channels at low pH or in the presence of non-proton ligands. Sci Rep. 2019;9:6781 pubmed publisher
Czikora I, Alli A, Sridhar S, Matthay M, Pillich H, Hudel M, et al. Epithelial Sodium Channel-α Mediates the Protective Effect of the TNF-Derived TIP Peptide in Pneumolysin-Induced Endothelial Barrier Dysfunction. Front Immunol. 2017;8:842 pubmed publisher
Díez García A, Barros Zulaica N, Nunez A, Buño W, Fernandez de Sevilla D. Bidirectional Hebbian Plasticity Induced by Low-Frequency Stimulation in Basal Dendrites of Rat Barrel Cortex Layer 5 Pyramidal Neurons. Front Cell Neurosci. 2017;11:8 pubmed publisher
image
image 1 :
Alomone Labs M-100 image 1
Alomone Labs alpha/beta MitTx (? and ? subunits at a stoichometry of 1:1) activates ASIC1a channels heterologously expressed inXenopusoocytes. - Holding potential was -60 mV. ASIC1a channel was triggered with pH 5.5 where indicated by arrows. 2 nM followed by 20 nM alpha/beta MitTx(#M-100) were used to activate ASIC1a current.
product information
cat :
M-100
SKU :
M-100_0.1 mg
Product Name :
MitTx Toxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
G9I930
Accession Number :
https://www.uniprot.org/uniprotkb/G9I930/entry, https://www.uniprot.org/uniprotkb/G9I929/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Micrurus tener tener (Texas coral snake).
Source :
Natural protein
Gene ID :
ASIC1,ASIC1a,ASIC1b,ASIC2a,ASIC3
Product Page - Scientific background :
alpha/beta MitTx (MitTx toxin) is a natural toxin isolated from the Texas Coral snake venom1. The purified active toxin consists of a heteromeric complex between Kunitz (α subunit) and phospholipase-A2-like (β subunit) proteins that together function as a potent, persistent and selective agonist for acid-sensing ion channels (ASICs), showing equal or greater efficacy compared with acidic pH1.MitTx-α and MitTx-β form a high affinity 1:1 complex, and neither subunit demonstrates functional effects on its own1,2.The purified ASIC-activating component of the venom, MitTx, was found to be sufficient to elicit robust nocifensive behaviors and is likely responsible for the lasting pain experienced by victims of coral snake envenomation2.
Supplier :
Alomone Labs
Target :
ASIC1 channels
Long Description :
An Activator of ASIC1-Containing Channels
Short Description :
An Activator of ASIC1-Containing Channels
MW :
20.84 kDa (alpha subunit, 7.104 kDa and beta subunit, 13.736 kDa)
Synonyms :
MitTx, alpha/beta MitTx
Modifications :
MitTx-alpha subunit contains pyrrolidone carboxylic acid at the N-terminus.
Effective Concentration :
20 nM
Activity :
MitTx toxin activates ASIC1-containing channels1,2.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
MitTx-beta subunit:NLNQFRLMIKCTNDRVWADFVDYGCYCVARDSNTPVDDLDRCCQAQKQCYDEAVKVHGCKPLVMFYSFECRYLASDLDCSGNNTKCRNFVCNCDRTATLCILTATYNRNNHKIDPSRCQ
subunit:QIRPAFCYEDPPFFQKCGAFVDSYYFNRSRI
TCVHFFYGQCDVNQNHFTTMSECNRVCHG
MitTx-alpha
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
yes
Cited Application :
Electrophysiology
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel