Recombinant human LIF protein | Alomone Labs L-200 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Recombinant human LIF protein

catalog :

L-200

more info or order :

Alomone Labs product webpage

citations: 6

Reference
Steelman A, Zhou Y, Koito H, Kim S, Payne H, Lu Q, et al. Activation of oligodendroglial Stat3 is required for efficient remyelination. Neurobiol Dis. 2016;91:336-46 pubmed publisher
Tsai P, Bake S, Balaraman S, Rawlings J, Holgate R, Dubois D, et al. MiR-153 targets the nuclear factor-1 family and protects against teratogenic effects of ethanol exposure in fetal neural stem cells. Biol Open. 2014;3:741-58 pubmed publisher
Tingling J, Bake S, Holgate R, Rawlings J, Nagsuk P, Chandrasekharan J, et al. CD24 expression identifies teratogen-sensitive fetal neural stem cell subpopulations: evidence from developmental ethanol exposure and orthotopic cell transfer models. PLoS ONE. 2013;8:e69560 pubmed publisher
Balaraman S, Winzer Serhan U, Miranda R. Opposing actions of ethanol and nicotine on microRNAs are mediated by nicotinic acetylcholine receptors in fetal cerebral cortical-derived neural progenitor cells. Alcohol Clin Exp Res. 2012;36:1669-77 pubmed publisher
Koechling T, Khalique H, Sundstrom E, Avila J, Lim F. A culture model for neurite regeneration of human spinal cord neurons. J Neurosci Methods. 2011;201:346-54 pubmed publisher
Camarillo C, Miranda R. Ethanol exposure during neurogenesis induces persistent effects on neural maturation: evidence from an ex vivo model of fetal cerebral cortical neuroepithelial progenitor maturation. Gene Expr. 2008;14:159-71 pubmed

image

image 1 :

image 2 :

Alomone Labs Recombinant human LIF protein activates ERK1/2 MAPK and STAT3 in 3T3-L1 cells. - Cells were serum starved for 2 h and stimulated with 100 ng/ml of Recombinanthuman LIF protein(#L-200) for 10 min. Cell proteins were resolved by SDS-PAGE and probed with anti-phospho-STAT3 and anti-phospho-ERK1/2.

product information

cat :

L-200

SKU :

L-200_0.1 mg

Product Name :

Recombinant human LIF protein

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P15018

Accession Number :

https://www.uniprot.org/uniprotkb/P15018/entry

Applications :

Western blot

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Source :

Recombinant, E. coli

Gene ID :

LIFR, IL6ST

Product Page - Scientific background :

Leukemia inhibitory factor (LIF) was identified by its ability to induce terminal differentiation in leukemic cells.1,2 LIF is a pleiotrophic factor with known actions in the immune system, the nervous system and the reproductive systeM3,4In the nervous system it acts on cultured sympathetic neurons to direct a change in neurotransmitter expression from a noradrenergic to a cholinergic phenotype and regulates the expression of neuropeptide transmitters in these cells.5,6In the immune system LIF plays a key role in inflammation,7,8 with a pro-inflammatory role in rheumatoid arthritis,9 but also with proposed anti-inflammatory properties in lung inflammatory processes.In the reproductive system, LIF appears to play an important role in implantation and in the establishment of pregnancy.10,12 LIF acts as a trophic factor for oligodendrocytes and promotes astrocytic survival and differentiation.13,14 It exhibits activity towards spinal motor neurons and stimulate the biosynthesis of acetylcholine.6LIF also functions as a trophic factor for peripheral sensory neurons supporting their survival.15,16 LIF appears to be essential for injury-induced neuropeptide synthesis17 and can also stimulate the hypothalamic-pituitary-adrenal axis in response to stress and disease.18 LIF is used extensively in experimental biology because of its ability to induce embryonic stem cells to retain their totipotentiality.

Supplier :

Alomone Labs

Target :

LIF receptor (LIFR-α)

Long Description :

Human Leukemia Inhibitory Factor, Recombinant, E. coli

Short Description :

Human Leukemia Inhibitory Factor, Recombinant, E. coli

MW :

19.7 kDa

Synonyms :

Leukemia Inhibitory Factor

Effective Concentration :

EC50 = ~10 pM

Activity :

LIF is a lymphoid factor which promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. LIF regulates cholinergic, peptidergic and noradrenergic properties of sympathetic neurons and rescues sensory and motor neurons from death. LIF also promotes differentiation of O-2A astrocytes1-4.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANA
LFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKA
KLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNA
TADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVF
QKKKLGCQLLGKYKQIIAVLAQAF-OH

Is Toxin :

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage