chemical

Recombinant rat IGF-I protein

I-200

I-200_0.1 mg

Recombinant rat IGF-I protein

Non Antibodies

Proteins

P08025

https://www.uniprot.org/uniprotkb/P08025/entry.

Cell proliferation assay

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Recombinant, E. coli

IGF1R, INSR

Insulin-like growth factor-I (IGF-I) belongs to the insulin family which is divided in two groups of peptides: 1- insulin and IGFs and 2- relaxin and insulin-like hormones. The structure of mature IGF-I is composed of a single polypeptide chain of 70 amino acids with 57 amino acids being identical across different organisms1,2.IGF-I is a pleiotropic factor responsible for the regulation of several cellular processes depending on its concentration, cell type and the developmental stage of the organisMIGF-I binds to IGF-I receptor and triggers the auto phosphorylation of the receptor and the activation of the insulin receptor substrates1.In the embryonic brain IGF-I expression is relatively high and drops sharply in the adult brain except in the hippocampus and the subventricular zone-olfactory bulb. In adults IGF-I is mainly synthesized in the liver though a process regulated by the growth hormone (GH). IGF-I can cross the blood-brain-barrier by binding to the IGF-I receptor present on endothelial cells and is later picked up by astrocytes to be transferred to neurons or directly by neurons1,2.Studies show that IGF-I influences neural stem cell proliferation and differentiation into neurons and glia as well as neuronal maturation including synapse formation. IGF-I also promotes adult neurogenesis by regulating neural stem cell number and differentiation1.

Alomone Labs

IGF receptor

Rat Insulin-like growth factor I, Recombinant, E. coli

Rat Insulin-like growth factor I, Recombinant, E. coli

7686.9 Da

Insulin-like growth factor I, Somatomedin C, IGF-1, IGFIA, IGF1, IBP1

Disulfide bonds between: Cys6-Cys48, Cys18-Cys61, and Cys47-Cys52

C336H522N94O99S7

The ED50 as determined by a cell proliferation assay using FDC-P1 cells is less than 2.0 ng/ml, corresponding to a specific activity of >500,000 units/mg.rat IGF-I is fully biologically active when compared to standards. The ED50 shown in literature was calculated in two different methods: 1. Stimulation of protein synthesis in rat L6 myoblasts ED50 was found to be less than 30 ng/ml 2. Type 1 IGF receptor binding assay ED50 was found to be less than 10 ng/ml

IGF-I is a pleiotropic factor involved in multiple processes, so its actions are different depending on its concentration, the cell type, and the developmental stage of the animal1. IGF-I promotes proliferation of neural cells by interacting with the IGF-IR which may activate the PI3K/Akt or the MAP kinase pathways1.Evidence indicates that IGF-I promotes cell survival by inhibiting apoptosis both in vivo and in vitro. IGF-I is also involved in the regulation of the migration of certain cell types1.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAP
QTGIVDECCFRSCDLRRLEMYCAPLKPTKSA-OH

No

12352202

yes

no