product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
human GALP (3-32)
catalog :
GPG-250
more info or order :
image
image 1 :

Western blot analysis of mouse brain membranes: - 1.Anti-GLUT2 (SLC2A2) Antibody (#AGT-022) (1:200).2. Anti-GLUT2 (SLC2A2) Antibody preincubated with the negative control antigen.
product information
cat :
GPG-250
SKU :
GPG-250_1 mg
Product Name :
human GALP (3-32)
Group Type :
Non Antibodies
Product Type :
Proteins
Applications :
Aequorin functional assay / Calcium imaging assay
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Source :
Synthetic peptide
Gene ID :
GALR1, GALR2, GALR3
Product Page - Scientific background :
Human GALP (3-32) fragment is a human galanin-like peptide that acts as a non-selective and potent galanin receptor agonist. Human GALP consists of 60 amino acid with a potential proteolytic cleavage site between two basic amino acids in position 33.Human GALP (3-32) shares amino acids in position 9-21 with the first 13 amino acids of galanin, an essential sequence for activating galanin receptors1,2. Galanin receptors belong to the family of G-protein coupled receptors and consist of three subtypes: GalR1, GalR2, and GalR3.Human GALP (3-32) is at least as potent as full length GALP. Studies suggest that GALP (3-32) fragment can represent the strongest mediator of biological GALP activity. GALP (3-32) can be used as a useful tool for studding the affinity of GALP to galanin receptors and to search for specific GALP receptors1,2. Human GALP (3-32) displays highest affinity to GalR3 with an IC50 value of 10 nM, followed by GalR2 with IC50 of 28 nM and GalR1 with IC50 of 77 nM1.
Supplier :
Alomone Labs
Target :
Galanin receptors
Long Description :
A Non-Selective and Potent Agonist of Galanin Receptors
Short Description :
A Non-Selective and Potent Agonist of Galanin Receptors
MW :
3102 Da
Synonyms :
Galanin-like peptide (3-32)
Molecular formula :
C137H213N43O38S1
Effective Concentration :
1 - 50 nM
Activity :
Human GALP (3-32) is a Galanin receptor agonist1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
AHRGRGGWTLNSAGYLLGPVLHLPQMGDQ-OH
Is Toxin :
No
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments
