product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
mouse, rat Galanin
catalog :
GPG-100
more info or order :
image
image 1 :

Alomone Labs Zolpidem inhibits specific binding of Ro-15-1788 to cerebellum GABA(A) receptors. - Percent inhibition of specific binding of 1 nM[3H] Ro-15-1788 to membranes from rat cerebellum plotted against increasing concentrations ofZolpidem(#Z-100). Full inhibition is achieved at over 50 nM.
product information
cat :
GPG-100
SKU :
GPG-100_0.5 mg
Product Name :
mouse, rat Galanin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P10683
Accession Number :
https://www.uniprot.org/uniprotkb/P10683/entry
Applications :
Aequorin functional assay / Calcium imaging assay
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Source :
Synthetic peptide
Gene ID :
GALR1, GALR2, GALR3
Product Page - Scientific background :
Galanin is a peptide hormone that acts as a non-selective and potent galanin receptor agonist. Galanin is a C-terminally amidated 29-residue peptide (30 in humans). It was first isolated from porcine intestine1,2.Galanin is widely distributed throughout the central and peripheral nervous systems and its biological activity includes contraction or relaxation of gut smooth muscles, inhibition of insulin and somatostatin release, and modulation of hormone secretion from the pituitary and adrenal gland. It is believed that galanin plays an important role as a neuromodulator of endocrine secretion and synaptic transmission1.Galanin receptors belong to the family of G-protein coupled receptors and consist of three subtypes: GalR1, GalR2, and GalR3. Additional studies show that galanin and its receptors are involved in the transmission and modulation of nociception2.
Supplier :
Alomone Labs
Target :
Galanin receptors
Long Description :
A Non-Selective, Potent Galanin Receptor Agonist
Short Description :
A Non-Selective, Potent Galanin Receptor Agonist
MW :
3164 Da
Modifications :
Thr29 - C-terminal amidation
Molecular formula :
C141H211N43O41
Effective Concentration :
1 - 10 nM
Activity :
Galanin receptor agonist1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
114547-31-8
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
Is Toxin :
No
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments
