mouse, rat Galanin | Alomone Labs GPG-100 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

mouse, rat Galanin

catalog :

GPG-100

more info or order :

Alomone Labs product webpage

image

image 1 :

Alomone Labs Zolpidem inhibits specific binding of Ro-15-1788 to cerebellum GABA(A) receptors. - Percent inhibition of specific binding of 1 nM[3H] Ro-15-1788 to membranes from rat cerebellum plotted against increasing concentrations ofZolpidem(#Z-100). Full inhibition is achieved at over 50 nM.

product information

cat :

GPG-100

SKU :

GPG-100_0.5 mg

Product Name :

mouse, rat Galanin

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P10683

Accession Number :

https://www.uniprot.org/uniprotkb/P10683/entry

Applications :

Aequorin functional assay / Calcium imaging assay

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Source :

Synthetic peptide

Gene ID :

GALR1, GALR2, GALR3

Product Page - Scientific background :

Galanin is a peptide hormone that acts as a non-selective and potent galanin receptor agonist. Galanin is a C-terminally amidated 29-residue peptide (30 in humans). It was first isolated from porcine intestine1,2.Galanin is widely distributed throughout the central and peripheral nervous systems and its biological activity includes contraction or relaxation of gut smooth muscles, inhibition of insulin and somatostatin release, and modulation of hormone secretion from the pituitary and adrenal gland. It is believed that galanin plays an important role as a neuromodulator of endocrine secretion and synaptic transmission1.Galanin receptors belong to the family of G-protein coupled receptors and consist of three subtypes: GalR1, GalR2, and GalR3. Additional studies show that galanin and its receptors are involved in the transmission and modulation of nociception2.

Supplier :

Alomone Labs

Target :

Galanin receptors

Long Description :

A Non-Selective, Potent Galanin Receptor Agonist

Short Description :

A Non-Selective, Potent Galanin Receptor Agonist

MW :

3164 Da

Modifications :

Thr29 - C-terminal amidation

Molecular formula :

C141H211N43O41

Effective Concentration :

1 - 10 nM

Activity :

Galanin receptor agonist1.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

CAS No :

114547-31-8

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2

Is Toxin :

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage