This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Alomone Labs
product type :
chemical
product name :
human Galanin
catalog :
GPG-050
product information
cat :
GPG-050
SKU :
GPG-050_0.5 mg
Product Name :
human Galanin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P22466
Accession Number :
https://www.uniprot.org/uniprotkb/P22466/entry
Applications :
Aequorin functional assay / Calcium imaging assay
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Source :
Synthetic peptide
Gene ID :
GALR1, GALR2, GALR3
Product Page - Scientific background :
Galanin is a peptide hormone that acts as a non-selective and potent galanin receptor agonist. In human, Galanin is a C-terminal-amidated 30-residue peptide deriving its name from the N-terminal glycine and C-terminal alanine residue1,2. Galanin receptors belong to the family of G-protein coupled receptors and consist of three subtypes: GalR1, GalR2, and GalR3.Galanin is widely distributed through the central and peripheral nervous system and its biological activity includes contraction or relaxation of gut smooth muscles, inhibition of insulin and somatostatin release, and modulation of hormone secretion from the pituitary and adrenal glands. It is believed that galanin plays an important role as a neuromodulator of endocrine secretion and synaptic transmission1. Additional studies show that galanin and its receptors are involved in the transmission and modulation of nociception of the central nervous system, at spinal cord levels and in the brain2.
Supplier :
Alomone Labs
Target :
Galanin receptors
Long Description :
A Non-Selective and Potent Agonist of Galanin Receptors
Short Description :
A Non-Selective and Potent Agonist of Galanin Receptors
MW :
3157 Da
Molecular formula :
C139H210N42O43
Effective Concentration :
1 - 10 nM
Activity :
Galanin receptor agonist1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
119418-04-1
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS-OH
Is Toxin :
No
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel