product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Recombinant human GDNF protein
catalog :
G-240
more info or order :
citations: 8
Reference |
---|
image
image 1 :

Alomone Labs ?-Conotoxin SVIB inhibits CaV2.2 currents heterologously expressed inXenopusoocytes. - A. Time course of?-Conotoxin SVIB(#STC-160) inhibition of CaV2.2 maximum current amplitude. Membrane potential was held at -100 mV and currents were elicited by a 100 ms voltage ramp to +50 mV in 2 mM Ba2+. ?-Conotoxin SVIB was applied at 50 nM for 3 min (green). B. Superimposed traces of CaV2.2 current upon application of control (black) and of 50 nM ?-Conotoxin SVIB (green) taken from the recording shown in A.
image 2 :

Alomone Labs Recombinant human GDNF protein induces PKB (Akt) and ERK1/2 MAPK activation in SH-SY5Y cells. - Cells were serum starved for 2 h and then stimulated with various concentrations of Recombinanthuman GDNF protein(#G-240) for 10 min. Cell proteins were resolved by SDS-PAGE and probed with anti-phospho(Ser473)-Akt (upper panel) and anti-phospho-ERK1/2 (lower panel).
product information
cat :
G-240
SKU :
G-240_0.1 mg
Product Name :
Recombinant human GDNF protein
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P39905
Accession Number :
https://www.uniprot.org/uniprotkb/P39905/entry
Applications :
Western blot
Formulation :
Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Source :
Recombinant, E. coli
Gene ID :
GFRA1, RET
Product Page - Scientific background :
Glial-derived neurotrophic factor (GDNF) is a member of the TGF-β superfamily. GDNF signals through a multi-component receptor system, composed of a RET proto-oncogene and one of the four α1-α4 receptors.1GDNF promotes survival of various neuronal cells, including motoneurons,2,3 Purkinje cells and sympathetic neurons.4 In embryonic midbrain cultures, GDNF promotes the survival and morphological differentiation of dopaminergic neurons and increases their high-affinity DA uptake.5 Cells that express GDNF include Sertoli cells, type 1 astrocytes, Schwann cells,6 neurons, pinealocytes, and skeletal muscle cells.7In vivo, following transection of facial motor neuron axons, locally applied GDNF has been shown to rescue virtually all damaged neurons from cell death.8 GDNF may be of clinical relevance in the treatment of Parkinson's disease that is characterized by progressive degeneration of midbrain dopaminergic neurons.9,10
Supplier :
Alomone Labs
Target :
GFRA1
Long Description :
Human Glial-Derived Neurotrophic Factor, Recombinant, E. coli
Short Description :
Human Glial-Derived Neurotrophic Factor, Recombinant, E. coli
MW :
30.1 kDa (dimer)
Synonyms :
Glial Cell Line-Derived Neurotrophic Factor
Effective Concentration :
1 - 10 ng/ml
Activity :
GDNF enhances survival and differentiation of dopaminergic neurons. It is also a potent survival factor for motor neurons1-3.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNR
GCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETT
YDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDN
LVYHILRKHSAKRCGCI-OH
GCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETT
YDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDN
LVYHILRKHSAKRCGCI-OH
Is Toxin :
No
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
yes
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments