Recombinant human GDNF protein | Alomone Labs G-240 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Recombinant human GDNF protein

catalog :

G-240

more info or order :

Alomone Labs product webpage

citations: 8

Reference
Ionescu A, Gradus T, Altman T, Maimon R, Saraf Avraham N, Geva M, et al. Targeting the Sigma-1 Receptor via Pridopidine Ameliorates Central Features of ALS Pathology in a SOD1G93A Model. Cell Death Dis. 2019;10:210 pubmed publisher
Izumi Y, Wakita S, Kanbara C, Nakai T, Akaike A, Kume T. Integrin α5β1 expression on dopaminergic neurons is involved in dopaminergic neurite outgrowth on striatal neurons. Sci Rep. 2017;7:42111 pubmed publisher
Joyce P, Fratta P, Landman A, McGoldrick P, Wackerhage H, Groves M, et al. Deficiency of the zinc finger protein ZFP106 causes motor and sensory neurodegeneration. Hum Mol Genet. 2016;25:291-307 pubmed publisher
Zhai J, Zhang L, Mojsilovic Petrovic J, Jian X, Thomas J, Homma K, et al. Inhibition of Cytohesins Protects against Genetic Models of Motor Neuron Disease. J Neurosci. 2015;35:9088-105 pubmed publisher
Murakami K, Tanaka T, Bando Y, Yoshida S. Nerve injury induces the expression of syndecan-1 heparan sulfate proteoglycan in primary sensory neurons. Neuroscience. 2015;300:338-50 pubmed publisher
Zhang L, Hsu F, Mojsilovic Petrovic J, Jablonski A, Zhai J, Coulter D, et al. Structure-function analysis of SAP97, a modular scaffolding protein that drives dendrite growth. Mol Cell Neurosci. 2015;65:31-44 pubmed publisher
Zahavi E, Ionescu A, Gluska S, Gradus T, Ben Yaakov K, Perlson E. A compartmentalized microfluidic neuromuscular co-culture system reveals spatial aspects of GDNF functions. J Cell Sci. 2015;128:1241-52 pubmed publisher
Kelly C, Thymiakou E, Dixon J, Tanaka S, Godwin J, Episkopou V. Rnf165/Ark2C enhances BMP-Smad signaling to mediate motor axon extension. PLoS Biol. 2013;11:e1001538 pubmed publisher

image

image 1 :

Alomone Labs ?-Conotoxin SVIB inhibits CaV2.2 currents heterologously expressed inXenopusoocytes. - A. Time course of?-Conotoxin SVIB(#STC-160) inhibition of CaV2.2 maximum current amplitude. Membrane potential was held at -100 mV and currents were elicited by a 100 ms voltage ramp to +50 mV in 2 mM Ba2+. ?-Conotoxin SVIB was applied at 50 nM for 3 min (green). B. Superimposed traces of CaV2.2 current upon application of control (black) and of 50 nM ?-Conotoxin SVIB (green) taken from the recording shown in A.

image 2 :

Alomone Labs Recombinant human GDNF protein induces PKB (Akt) and ERK1/2 MAPK activation in SH-SY5Y cells. - Cells were serum starved for 2 h and then stimulated with various concentrations of Recombinanthuman GDNF protein(#G-240) for 10 min. Cell proteins were resolved by SDS-PAGE and probed with anti-phospho(Ser473)-Akt (upper panel) and anti-phospho-ERK1/2 (lower panel).

product information

cat :

G-240

SKU :

G-240_0.1 mg

Product Name :

Recombinant human GDNF protein

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P39905

Accession Number :

https://www.uniprot.org/uniprotkb/P39905/entry

Applications :

Western blot

Formulation :

Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Source :

Recombinant, E. coli

Gene ID :

GFRA1, RET

Product Page - Scientific background :

Glial-derived neurotrophic factor (GDNF) is a member of the TGF-β superfamily. GDNF signals through a multi-component receptor system, composed of a RET proto-oncogene and one of the four α1-α4 receptors.1GDNF promotes survival of various neuronal cells, including motoneurons,2,3 Purkinje cells and sympathetic neurons.4 In embryonic midbrain cultures, GDNF promotes the survival and morphological differentiation of dopaminergic neurons and increases their high-affinity DA uptake.5 Cells that express GDNF include Sertoli cells, type 1 astrocytes, Schwann cells,6 neurons, pinealocytes, and skeletal muscle cells.7In vivo, following transection of facial motor neuron axons, locally applied GDNF has been shown to rescue virtually all damaged neurons from cell death.8 GDNF may be of clinical relevance in the treatment of Parkinson's disease that is characterized by progressive degeneration of midbrain dopaminergic neurons.9,10

Supplier :

Alomone Labs

Target :

GFRA1

Long Description :

Human Glial-Derived Neurotrophic Factor, Recombinant, E. coli

Short Description :

Human Glial-Derived Neurotrophic Factor, Recombinant, E. coli

MW :

30.1 kDa (dimer)

Synonyms :

Glial Cell Line-Derived Neurotrophic Factor

Effective Concentration :

1 - 10 ng/ml

Activity :

GDNF enhances survival and differentiation of dopaminergic neurons. It is also a potent survival factor for motor neurons1-3.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNR
GCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETT
YDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDN
LVYHILRKHSAKRCGCI-OH

Is Toxin :

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

yes

more info or order :

Alomone Labs product webpage