protein

human GDNF-Biotin

G-240-B

G-240-B_10 mcg

human GDNF-Biotin

Non Antibodies

Proteins

Western blot, Live cell imaging, Immunofluorescence, Fluorescence staining, Indirect flow cytometry

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Store the reconstituted solution for the shortest time possible at -20°C. We do not recommend storing the product in working solution for longer than one day. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Modified recombinant protein, E. coli

GFRA1, RET

Glial-derived neurotrophic factor (GDNF) is a member of the TGF-β superfamily. GDNF signals through a multi-component receptor system, composed of a RET proto-oncogene and one of the four α1-α4 receptors.1 GDNF promotes survival of various neuronal cells, including motoneurons,2,3 Purkinje cells and sympathetic neurons.4 In embryonic midbrain cultures, GDNF promotes the survival and morphological differentiation of dopaminergic neurons and increases their high-affinity DA uptake.5 Cells that express GDNF include Sertoli cells, type 1 astrocytes, Schwann cells,6 neurons, pinealocytes, and skeletal muscle cells.7 In vivo, following transection of facial motor neuron axons, locally applied GDNF has been shown to rescue virtually all damaged neurons from cell death.8 GDNF may be of clinical relevance in the treatment of Parkinson's disease that is characterized by progressive degeneration of midbrain dopaminergic neurons.9,10

Alomone Labs

GFRA1 (GDNFR-Alpha-1), RET Receptor Tyrosine Kinase

human GDNF-Biotin (#G-240-B) is a highly pure, recombinant, and biologically active conjugated protein. Benefits of human GDNF-Biotin: ✓ Localization and distribution ✓ Live cell imaging ✓ Single cell detection ✓ Indirect flow cytometry We gladly take on collaboration projects. Please Contact Us.

30.8 kDa (dimer)

Glial Cell Line-Derived Neurotrophic Factor

LC-Biotin

1 nM – 0.1 µM

GDNF enhances survival and differentiation of dopaminergic neurons. It is also a potent survival factor for motor neurons1-3.

Store the reconstituted solution for the shortest time possible at -20°C. We do not recommend storing the product in working solution for longer than one day. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

Lyophilized

Contact Alomone Labs for technical support and product customization

SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNR
GCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETT
YDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDN
LVYHILRKHSAKRCGCI-OH

12352202

yes

no