FS-2 | Alomone Labs F-700 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

FS-2

catalog :

F-700

more info or order :

Alomone Labs product webpage

image

image 1 :

Expression of Sphingosine 1-phosphate receptor 1 in mouse 3T3 cells - Cell surface detection of Sphingosine 1-phosphate receptor 1 inmouse live 3T3 cells. A. Extracellular staining of cells using Anti-S1PR1 (EDG1) (extracellular) Antibody(#ASR-011) (1:50)(red). B. DAPI is used for nuclear staining (blue). Merged image of A and B.

image 2 :

Alomone Labs FS-2 inhibits CaV1.2 channels heterologously expressed inXenopusoocytes. 1 M FS-2 was also used to inhibit high K+or glucose-induced L-type Ca2+influx in RIN B insulinoma cells. - Left: 500 nMFS-2(#F-700) inhibits 50% of L-type CaVcurrents inXenopusoocytes across the voltage range.Right: Example traces of Ca2+current responses to depolarization to +20 mV before and during application of FS-2.

product information

cat :

F-700

SKU :

F-700_70 mcg

Product Name :

FS-2

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P01414

Accession Number :

https://www.uniprot.org/uniprotkb/P01414/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Dendroaspis polylepis polylepis (Black mamba snake).

Source :

Natural protein

Gene ID :

CACNA1C,CACNA1D,CACNA1F,CACNA1S

Product Page - Scientific background :

FS-2 is a natural peptidyl toxin isolated from the Dendroaspis p. polylepsis black mamba venom by a modification of the procedure of Schweitz et al.1 and purified to homogenity. FS-2 is an L-type CaV channel blocker.2 The toxin reduced (±)Bay K8644-induced [Ca2+]in increase, in smooth muscle cells as determined by Ca2+ imaging with Fura-2.2 The IC50 for this effect was 23 nMFS-2 induced relaxation in pre-constricted rat aorta, pulmonary artery and trachea.3 In addition, it inhibited acetylcholine-induced contractions in guinea pig ileuM

Supplier :

Alomone Labs

Target :

L-type Ca2+ channels

Long Description :

A Blocker of L-Type CaV Channels

Short Description :

A Blocker of L-Type CaV Channels

MW :

7018 Da

Synonyms :

Toxin FS-2, FS2

Modifications :

Disulfide bonds between: Cys3-Cys22, Cys17-Cys39, Cys41-Cys52 and Cys53-Cys58

Molecular formula :

C297N462N92O86S10

Effective Concentration :

100 nM - 2 µM

Activity :

FS-2 is an L-type CaV channel blocker1.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

CAS No :

63653-99-6

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

RICYSHKASLPRATKTCVENTCYKMFIRTHRQYISERGC
GCPTAMWPYQTECCKGDRCNK-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage