product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Fasciculin-I
catalog :
F-650
more info or order :
citations: 1
image
image 1 :

Alomone Labs Fasciculin-Ipotently inhibits Acetylcholinesterase (AChE) activity. - AChE activity was determined colorimetrically using Ellman's reagent as production of thiocholine from acetylthiocholine. Absorbance was measured at 405 nm after a 30 min incubation. Normalized activity of 400 mU/ml human AChE as per cent of control was plotted against increasing concentrations ofFasciculin-I(#F-650) showing concentration-dependent inhibition with pIC50? 6.7.
image 2 :

Expression of Sphingosine 1-phosphate receptor 1 in rat lung - Immunohistochemical staining of paraffin embedded rat lung sections using Anti-S1PR1 (EDG1) (extracellular) Antibody(#ASR-011) (1:100). Staining is present in vascular smooth muscle (black arrows) but not in the muscular layer of bronchi(red arrows). Hematoxilin is used as the counterstain.
product information
cat :
F-650
SKU :
F-650_70 mcg
Product Name :
Fasciculin-I
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P0C1Y9
Accession Number :
https://www.uniprot.org/uniprotkb/P0C1Y9/entry
Applications :
Acetylcholinesterase (AChE) activity
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Dendroaspis angusticeps (Eastern green mamba).
Source :
Natural protein
Gene ID :
ACHE
Product Page - Scientific background :
Fasciculin-I is a 61 amino acid peptidyl toxin with four disulfide bonds, isolated from the Eastern green mamba (Dendroaspis angusticeps) venom. Fasciculin-I belongs to the three finger toxin family, structurally similar to the short alpha-neurotoxins and cardiotoxins1.Fasciculin-I was shown to be a selective, potent, and reversible blocker of the mammalian acetylcholinesterase (AChE) at picomolar concentrations1. Injection of Fasciculin-I to mice causes severe generalized and long-lasting twitch (fasciculation) due to its ability to accumulate acetylcholine at the neuromuscular junction2.
Supplier :
Alomone Labs
Target :
Acetylcholinesterase (AChE)
Long Description :
A Potent and Reversible Blocker of Acetylcholinesterase
Short Description :
A Potent and Reversible Blocker of Acetylcholinesterase
MW :
6799 Da
Synonyms :
Fasciculin-1, Fas-1, Fas1, FAS-I, Toxin TA1
Modifications :
Disulfide bonds between: Cys3-Cys22, Cys17-Cys39, Cys41-Cys52 and Cys53-Cys59
Molecular formula :
C281H441N87O90S10
Effective Concentration :
1 - 10 nM
Activity :
Fasciculin-I selectively and potently binds and inhibits acetylcholinesterase.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥99% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
TMCYSHTTTSRAILTNCGENSCYRKSRRHPPKMVLGRGC
GCPPGDDYLEVKCCTSPDKCNY-OH
GCPPGDDYLEVKCCTSPDKCNY-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments
