chemical

Recombinant human FGF-b protein

F-170

F-170_0.1 mg

Recombinant human FGF-b protein

Non Antibodies

Proteins

P09038

https://www.uniprot.org/uniprotkb/P09038/entry

Cell proliferation assay

Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Recombinant, E. coli

FGF2, FGFR1, FGFR2, FGFR3, FGFR4, CSPG4, FGFBP1, TEC, FGFBP3, ITGAV, ITGB3

Fibroblast growth factor-basic (FGF-b, FGF-2) belongs to the 23 member FGF family.1 FGFs play major roles in development,2 wound healing,3 hematopoiesis,4 tumorigenesis,5 and angiogenesis.6 It is expressed mostly in tissues of mesoderm and neuroectoderm origin.7FGF-basic exists in four molecular forms, three high molecular weight (21.5, 22, and 24 kDa), and one 18 kDa forM8 The higher molecular weight forms are mainly nucleus associated. The 18 kDa form, which lacks a signal sequence, is cytoplasmic or found at the cell surface.9FGF-basic may be released from damaged cells or could be released by an exocytotic mechanism that is independent of the ER-Golgi pathway.10 Secreted FGF interacts with specific cell surface receptors. The FGF receptor family consists of four members: FGFR-1 (flg), FGFR-2 (bek, KGFR), FGFR-3 and FGFR-4. These receptors comprise a conserved tyrosine kinase domain, a transmembrane domain and an extracellular ligand binding domain.11 Binding of FGF-basic to its receptor is regulated by heparan sulfate proteoglycans.12FGF-basic is implicated in many biological processes. It has been shown to induce endothelial cell proliferation, migration and angiogenesis in vitro and in vivo,13 stimulate myeloid progenitors,14 stimulate stromal growth,15 promote the release of endothelium from its connective tissue anchor (thus encouraging the entry of new vascular endothelium),6 regulate oligodendrocyte progenitor proliferation and differentiation in culture,16 and play a role in the autonomous growth of melanoma cells.17

Alomone Labs

FGF receptors

Human Fibroblast Growth Factor-basic, Recombinant, E. coli

Human Fibroblast Growth Factor-basic, Recombinant, E. coli

16.5 kDa

Heparin-Binding Growth Factor 2, Basic Fibroblast Growth Factor

EC50 = ~17 pM

FGF-basic is a heparin binding growth factor which stimulates the proliferation of a wide variety of cells, including mesenchymal, neuroectodermal, endothelial, and smooth muscle cells, among many others. FGF-basic also induces neuronal and glial differentiation, survival and regeneration1-4.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMK
EDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYV
ALKRTGQYKLGSKTGPGQKAILFLPMSAKS

No

12352202

yes

yes