product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Recombinant human FGF-b protein
catalog :
F-170
more info or order :
citations: 7
Reference
Fleitas C, Piñol Ripoll G, Marfull P, Rocandio D, Ferrer I, Rampon C, et al. proBDNF is modified by advanced glycation end products in Alzheimer's disease and causes neuronal apoptosis by inducing p75 neurotrophin receptor processing. Mol Brain. 2018;11:68 pubmed publisher
Skalecka A, Liszewska E, Bilinski R, Gkogkas C, Khoutorsky A, Malik A, et al. mTOR kinase is needed for the development and stabilization of dendritic arbors in newly born olfactory bulb neurons. Dev Neurobiol. 2016;76:1308-1327 pubmed publisher
Birenboim R, Markus A, Goldstein R. Simple generation of neurons from human embryonic stem cells using agarose multiwell dishes. J Neurosci Methods. 2013;214:9-14 pubmed publisher
Zamburlin P, Ruffinatti F, Gilardino A, Farcito S, Lovisolo D. Calcium signals induced by FGF-2 in parasympathetic neurons: role of second messenger pathways. Neurosci Lett. 2012;523:30-4 pubmed publisher
Ziegler L, Grigoryan S, Yang I, Thakor N, Goldstein R. Efficient generation of schwann cells from human embryonic stem cell-derived neurospheres. Stem Cell Rev. 2011;7:394-403 pubmed publisher
Erriquez J, Gilardino A, Ariano P, Munaron L, Lovisolo D, Distasi C. Calcium signals activated by arachidonic acid in embryonic chick ciliary ganglion neurons. Neurosignals. 2005;14:244-54 pubmed
Vourc H P, Lacar B, Mignon L, Lucas P, Young H, Chesselet M. Effect of neurturin on multipotent cells isolated from the adult skeletal muscle. Biochem Biophys Res Commun. 2005;332:215-23 pubmed
image
image 1 :
Alomone Labs F-170 image 1
Expression of LRRK2 in rat striatum and substantia nigra - Immunohistochemical staining of perfusion-fixed frozen rat brain sections using Anti-LRRK2Antibody (#ANR-102) (1:400) followed by goat-anti-rabbit-AlexaFluor-488 secondary antibody. A. LRKK2 staining (green) of striatum sections is detected in the cytoplasm of several striatal cells (arrows). B. Staining in the substantia nigra pars compacta shows LRKK2 staining (green) in nuclei and cytoplasm of several cells (arrows). Nuclei were stained with DAPI (blue).
image 2 :
Alomone Labs F-170 image 2
Alomone Labs Recombinant human FGF-b protein promotes the proliferation of 3T3-L1 cells. - Cells were cultured with 10% bovine serum for 24 h then the serum was reduced to 0.5% and the cells were stimulated with increasing concentrations of Recombinanthuman FGF-b protein(#F-170). The cell proliferation was measured 2 days post stimulation using the XTT method.
product information
cat :
F-170
SKU :
F-170_0.1 mg
Product Name :
Recombinant human FGF-b protein
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P09038
Accession Number :
https://www.uniprot.org/uniprotkb/P09038/entry
Applications :
Cell proliferation assay
Formulation :
Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Source :
Recombinant, E. coli
Gene ID :
FGF2, FGFR1, FGFR2, FGFR3, FGFR4, CSPG4, FGFBP1, TEC, FGFBP3, ITGAV, ITGB3
Product Page - Scientific background :
Fibroblast growth factor-basic (FGF-b, FGF-2) belongs to the 23 member FGF family.1 FGFs play major roles in development,2 wound healing,3 hematopoiesis,4 tumorigenesis,5 and angiogenesis.6 It is expressed mostly in tissues of mesoderm and neuroectoderm origin.7FGF-basic exists in four molecular forms, three high molecular weight (21.5, 22, and 24 kDa), and one 18 kDa forM8 The higher molecular weight forms are mainly nucleus associated. The 18 kDa form, which lacks a signal sequence, is cytoplasmic or found at the cell surface.9FGF-basic may be released from damaged cells or could be released by an exocytotic mechanism that is independent of the ER-Golgi pathway.10 Secreted FGF interacts with specific cell surface receptors. The FGF receptor family consists of four members: FGFR-1 (flg), FGFR-2 (bek, KGFR), FGFR-3 and FGFR-4. These receptors comprise a conserved tyrosine kinase domain, a transmembrane domain and an extracellular ligand binding domain.11 Binding of FGF-basic to its receptor is regulated by heparan sulfate proteoglycans.12FGF-basic is implicated in many biological processes. It has been shown to induce endothelial cell proliferation, migration and angiogenesis in vitro and in vivo,13 stimulate myeloid progenitors,14 stimulate stromal growth,15 promote the release of endothelium from its connective tissue anchor (thus encouraging the entry of new vascular endothelium),6 regulate oligodendrocyte progenitor proliferation and differentiation in culture,16 and play a role in the autonomous growth of melanoma cells.17
Supplier :
Alomone Labs
Target :
FGF receptors
Long Description :
Human Fibroblast Growth Factor-basic, Recombinant, E. coli
Short Description :
Human Fibroblast Growth Factor-basic, Recombinant, E. coli
MW :
16.5 kDa
Synonyms :
Heparin-Binding Growth Factor 2, Basic Fibroblast Growth Factor
Effective Concentration :
EC50 = ~17 pM
Activity :
FGF-basic is a heparin binding growth factor which stimulates the proliferation of a wide variety of cells, including mesenchymal, neuroectodermal, endothelial, and smooth muscle cells, among many others. FGF-basic also induces neuronal and glial differentiation, survival and regeneration1-4.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMK
EDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYV
ALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Is Toxin :
No
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
yes
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel