chemical

Recombinant human EGF protein

E-100

E-100_0.1 mg

Recombinant human EGF protein

Non Antibodies

Proteins

P01133

https://www.uniprot.org/uniprotkb/P01133/entry

Western blot

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Recombinant, E. coli

EGFR

The epidermal growth factor (EGF) family is important in regulating growth, maturation, function, and maintenance in epithelial tissues (particularly the mammary glands and gastrointestinal tract) and the nerve systeM EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro1 and of some fibroblasts in cell culture2-3.The EGF family is comprised of 13 members, which are all membrane-anchored proteins, in addition to their properties as ligands that activate epidermal growth factor receptor (EGFR), bearing tyrosine kinase activity4.The EC50 of EGF is 0.05-5.0 ng/ml using Balb/MK cells5, and its importance as a potential therapeutic agent has been extended by the realization that EGF-like activities may be involved in wound healing and could alter cell growth in cancer3,6. The risk of cancer is increased by EGF and therefore, inhibiting it decreases cancer risk. There are two classes of inhibitors: the small-molecule EGFR tyrosine kinase inhibitors (SMTKIs) and monoclonal antibodies to the receptors7.EGF is also a magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Defects in EGF are the cause of hypomagnesemia type 4 (HOMG4), also known as renal hypomagnesemia normocalciuric. HOMG4 is a disorder characterized by massive renal hypomagnesemia and normal levels of serum calcium and calcium excretion. Clinical features include seizures, mild-to moderate psychomotor retardation, and brisk tendon reflexes8.

Alomone Labs

EGFR

Human Epidermal Growth Factor, Recombinant, E. coli

Human Epidermal Growth Factor, Recombinant, E. coli

6.2 kDa

Epidermal Growth Factor, Urogastrone, Beta Urogastrone, URG

EC50 = 20 pg/ml

EGF is a potent growth factor that stimulates both in vitro and in vivo the proliferation of various epidermal and epithelial cells1. Fibroblasts are also stimulated in vitro by EGF2,3.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIG
ERCQYRDLKWWELR-OH

No

12352202

yes

yes